Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1830
Gene name	Desmoglein 3
Gene symbol	DSG3
Synonyms (NCBI Gene)	ABOLMCDHF6PVA
Chromosome	18
Chromosome location	18q12.1
Summary	This gene encodes a member of the desmoglein family and cadherin cell adhesion molecule superfamily of proteins. Desmogleins are calcium-binding transmembrane glycoprotein components of desmosomes, cell-cell junctions between epithelial, myocardial, and o

386

Show/Hide all (386)

miRTarBase ID	miRNA	Experiments	Reference
MIRT650030	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT650029	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT650028	hsa-miR-4532	HITS-CLIP	23824327
MIRT650027	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT650026	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT650025	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT650024	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT650023	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT650022	hsa-miR-4284	HITS-CLIP	23824327
MIRT650021	hsa-miR-1206	HITS-CLIP	23824327
MIRT650030	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT650029	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT650028	hsa-miR-4532	HITS-CLIP	23824327
MIRT650027	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT650026	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT650025	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT650024	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT650023	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT650022	hsa-miR-4284	HITS-CLIP	23824327
MIRT650021	hsa-miR-1206	HITS-CLIP	23824327
MIRT946108	hsa-let-7a	CLIP-seq
MIRT946109	hsa-let-7b	CLIP-seq
MIRT946110	hsa-let-7c	CLIP-seq
MIRT946111	hsa-let-7d	CLIP-seq
MIRT946112	hsa-let-7e	CLIP-seq
MIRT946113	hsa-let-7f	CLIP-seq
MIRT946114	hsa-let-7g	CLIP-seq
MIRT946115	hsa-let-7i	CLIP-seq
MIRT946116	hsa-miR-1193	CLIP-seq
MIRT946117	hsa-miR-125a-3p	CLIP-seq
MIRT946118	hsa-miR-1288	CLIP-seq
MIRT946119	hsa-miR-1294	CLIP-seq
MIRT946120	hsa-miR-1307	CLIP-seq
MIRT946121	hsa-miR-15a	CLIP-seq
MIRT946122	hsa-miR-15b	CLIP-seq
MIRT946123	hsa-miR-16	CLIP-seq
MIRT946124	hsa-miR-195	CLIP-seq
MIRT946125	hsa-miR-1976	CLIP-seq
MIRT946126	hsa-miR-202	CLIP-seq
MIRT946127	hsa-miR-203	CLIP-seq
MIRT946128	hsa-miR-214	CLIP-seq
MIRT946129	hsa-miR-2276	CLIP-seq
MIRT946130	hsa-miR-2392	CLIP-seq
MIRT946131	hsa-miR-3160-5p	CLIP-seq
MIRT946132	hsa-miR-3199	CLIP-seq
MIRT946133	hsa-miR-3619-5p	CLIP-seq
MIRT946134	hsa-miR-3665	CLIP-seq
MIRT946135	hsa-miR-383	CLIP-seq
MIRT946136	hsa-miR-3908	CLIP-seq
MIRT946137	hsa-miR-424	CLIP-seq
MIRT946138	hsa-miR-4252	CLIP-seq
MIRT946139	hsa-miR-4258	CLIP-seq
MIRT946140	hsa-miR-4279	CLIP-seq
MIRT946141	hsa-miR-4328	CLIP-seq
MIRT946142	hsa-miR-433	CLIP-seq
MIRT946143	hsa-miR-4418	CLIP-seq
MIRT946144	hsa-miR-4438	CLIP-seq
MIRT946145	hsa-miR-4458	CLIP-seq
MIRT946146	hsa-miR-4500	CLIP-seq
MIRT946147	hsa-miR-4662a-5p	CLIP-seq
MIRT946148	hsa-miR-4676-5p	CLIP-seq
MIRT946149	hsa-miR-4707-3p	CLIP-seq
MIRT946150	hsa-miR-4710	CLIP-seq
MIRT946151	hsa-miR-4712-3p	CLIP-seq
MIRT946152	hsa-miR-4722-3p	CLIP-seq
MIRT946153	hsa-miR-4735-5p	CLIP-seq
MIRT946154	hsa-miR-4740-3p	CLIP-seq
MIRT946155	hsa-miR-4743	CLIP-seq
MIRT946156	hsa-miR-4754	CLIP-seq
MIRT946157	hsa-miR-4772-5p	CLIP-seq
MIRT946158	hsa-miR-4775	CLIP-seq
MIRT946159	hsa-miR-497	CLIP-seq
MIRT946160	hsa-miR-509-3-5p	CLIP-seq
MIRT946161	hsa-miR-5095	CLIP-seq
MIRT946162	hsa-miR-509-5p	CLIP-seq
MIRT946163	hsa-miR-5096	CLIP-seq
MIRT946164	hsa-miR-548ac	CLIP-seq
MIRT946165	hsa-miR-548ae	CLIP-seq
MIRT946166	hsa-miR-548aj	CLIP-seq
MIRT946167	hsa-miR-548am	CLIP-seq
MIRT946168	hsa-miR-548d-3p	CLIP-seq
MIRT946169	hsa-miR-548x	CLIP-seq
MIRT946170	hsa-miR-548z	CLIP-seq
MIRT946171	hsa-miR-575	CLIP-seq
MIRT946172	hsa-miR-590-3p	CLIP-seq
MIRT946173	hsa-miR-640	CLIP-seq
MIRT946174	hsa-miR-761	CLIP-seq
MIRT946175	hsa-miR-98	CLIP-seq
MIRT946116	hsa-miR-1193	CLIP-seq
MIRT946125	hsa-miR-1976	CLIP-seq
MIRT946130	hsa-miR-2392	CLIP-seq
MIRT946142	hsa-miR-433	CLIP-seq
MIRT946147	hsa-miR-4662a-5p	CLIP-seq
MIRT946148	hsa-miR-4676-5p	CLIP-seq
MIRT946163	hsa-miR-5096	CLIP-seq
MIRT946171	hsa-miR-575	CLIP-seq
MIRT946173	hsa-miR-640	CLIP-seq
MIRT946116	hsa-miR-1193	CLIP-seq
MIRT946125	hsa-miR-1976	CLIP-seq
MIRT946130	hsa-miR-2392	CLIP-seq
MIRT1921459	hsa-miR-3149	CLIP-seq
MIRT1921460	hsa-miR-411	CLIP-seq
MIRT946142	hsa-miR-433	CLIP-seq
MIRT946147	hsa-miR-4662a-5p	CLIP-seq
MIRT946148	hsa-miR-4676-5p	CLIP-seq
MIRT1921461	hsa-miR-483-5p	CLIP-seq
MIRT946163	hsa-miR-5096	CLIP-seq
MIRT946171	hsa-miR-575	CLIP-seq
MIRT946173	hsa-miR-640	CLIP-seq
MIRT946116	hsa-miR-1193	CLIP-seq
MIRT946125	hsa-miR-1976	CLIP-seq
MIRT946130	hsa-miR-2392	CLIP-seq
MIRT1921459	hsa-miR-3149	CLIP-seq
MIRT1921460	hsa-miR-411	CLIP-seq
MIRT946142	hsa-miR-433	CLIP-seq
MIRT946147	hsa-miR-4662a-5p	CLIP-seq
MIRT946148	hsa-miR-4676-5p	CLIP-seq
MIRT946153	hsa-miR-4735-5p	CLIP-seq
MIRT946158	hsa-miR-4775	CLIP-seq
MIRT1921461	hsa-miR-483-5p	CLIP-seq
MIRT946163	hsa-miR-5096	CLIP-seq
MIRT946171	hsa-miR-575	CLIP-seq
MIRT946172	hsa-miR-590-3p	CLIP-seq
MIRT946173	hsa-miR-640	CLIP-seq
MIRT946116	hsa-miR-1193	CLIP-seq
MIRT946125	hsa-miR-1976	CLIP-seq
MIRT946130	hsa-miR-2392	CLIP-seq
MIRT1921459	hsa-miR-3149	CLIP-seq
MIRT1921460	hsa-miR-411	CLIP-seq
MIRT946142	hsa-miR-433	CLIP-seq
MIRT946147	hsa-miR-4662a-5p	CLIP-seq
MIRT946148	hsa-miR-4676-5p	CLIP-seq
MIRT1921461	hsa-miR-483-5p	CLIP-seq
MIRT946163	hsa-miR-5096	CLIP-seq
MIRT946171	hsa-miR-575	CLIP-seq
MIRT946173	hsa-miR-640	CLIP-seq
MIRT946116	hsa-miR-1193	CLIP-seq
MIRT946125	hsa-miR-1976	CLIP-seq
MIRT946130	hsa-miR-2392	CLIP-seq
MIRT1921459	hsa-miR-3149	CLIP-seq
MIRT1921460	hsa-miR-411	CLIP-seq
MIRT946142	hsa-miR-433	CLIP-seq
MIRT946147	hsa-miR-4662a-5p	CLIP-seq
MIRT946148	hsa-miR-4676-5p	CLIP-seq
MIRT946153	hsa-miR-4735-5p	CLIP-seq
MIRT946158	hsa-miR-4775	CLIP-seq
MIRT1921461	hsa-miR-483-5p	CLIP-seq
MIRT946163	hsa-miR-5096	CLIP-seq
MIRT946171	hsa-miR-575	CLIP-seq
MIRT946172	hsa-miR-590-3p	CLIP-seq
MIRT946173	hsa-miR-640	CLIP-seq
MIRT946116	hsa-miR-1193	CLIP-seq
MIRT946125	hsa-miR-1976	CLIP-seq
MIRT946130	hsa-miR-2392	CLIP-seq
MIRT1921459	hsa-miR-3149	CLIP-seq
MIRT1921460	hsa-miR-411	CLIP-seq
MIRT946142	hsa-miR-433	CLIP-seq
MIRT946147	hsa-miR-4662a-5p	CLIP-seq
MIRT946148	hsa-miR-4676-5p	CLIP-seq
MIRT946153	hsa-miR-4735-5p	CLIP-seq
MIRT946158	hsa-miR-4775	CLIP-seq
MIRT1921461	hsa-miR-483-5p	CLIP-seq
MIRT946163	hsa-miR-5096	CLIP-seq
MIRT946171	hsa-miR-575	CLIP-seq
MIRT946172	hsa-miR-590-3p	CLIP-seq
MIRT946173	hsa-miR-640	CLIP-seq
MIRT1980107	hsa-miR-106a	CLIP-seq
MIRT1980108	hsa-miR-106b	CLIP-seq
MIRT946116	hsa-miR-1193	CLIP-seq
MIRT1980109	hsa-miR-1234	CLIP-seq
MIRT946118	hsa-miR-1288	CLIP-seq
MIRT946120	hsa-miR-1307	CLIP-seq
MIRT1980110	hsa-miR-139-3p	CLIP-seq
MIRT1980111	hsa-miR-150	CLIP-seq
MIRT1980112	hsa-miR-17	CLIP-seq
MIRT946125	hsa-miR-1976	CLIP-seq
MIRT1980113	hsa-miR-20a	CLIP-seq
MIRT1980114	hsa-miR-20b	CLIP-seq
MIRT946129	hsa-miR-2276	CLIP-seq
MIRT946130	hsa-miR-2392	CLIP-seq
MIRT1980115	hsa-miR-2467-3p	CLIP-seq
MIRT1980116	hsa-miR-302a	CLIP-seq
MIRT1980117	hsa-miR-302b	CLIP-seq
MIRT1980118	hsa-miR-302c	CLIP-seq
MIRT1980119	hsa-miR-302d	CLIP-seq
MIRT1980120	hsa-miR-302e	CLIP-seq
MIRT1921459	hsa-miR-3149	CLIP-seq
MIRT1980121	hsa-miR-370	CLIP-seq
MIRT1980122	hsa-miR-372	CLIP-seq
MIRT1980123	hsa-miR-373	CLIP-seq
MIRT1921460	hsa-miR-411	CLIP-seq
MIRT946138	hsa-miR-4252	CLIP-seq
MIRT946139	hsa-miR-4258	CLIP-seq
MIRT1980124	hsa-miR-4294	CLIP-seq
MIRT946142	hsa-miR-433	CLIP-seq
MIRT946143	hsa-miR-4418	CLIP-seq
MIRT946144	hsa-miR-4438	CLIP-seq
MIRT946147	hsa-miR-4662a-5p	CLIP-seq
MIRT946148	hsa-miR-4676-5p	CLIP-seq
MIRT946149	hsa-miR-4707-3p	CLIP-seq
MIRT1980125	hsa-miR-4720-3p	CLIP-seq
MIRT1980126	hsa-miR-4731-5p	CLIP-seq
MIRT1980127	hsa-miR-4738-5p	CLIP-seq
MIRT946155	hsa-miR-4743	CLIP-seq
MIRT946156	hsa-miR-4754	CLIP-seq
MIRT946158	hsa-miR-4775	CLIP-seq
MIRT1980128	hsa-miR-4804-3p	CLIP-seq
MIRT1921461	hsa-miR-483-5p	CLIP-seq
MIRT946160	hsa-miR-509-3-5p	CLIP-seq
MIRT946161	hsa-miR-5095	CLIP-seq
MIRT946162	hsa-miR-509-5p	CLIP-seq
MIRT946163	hsa-miR-5096	CLIP-seq
MIRT1980129	hsa-miR-512-3p	CLIP-seq
MIRT1980130	hsa-miR-519d	CLIP-seq
MIRT1980131	hsa-miR-520a-3p	CLIP-seq
MIRT1980132	hsa-miR-520b	CLIP-seq
MIRT1980133	hsa-miR-520c-3p	CLIP-seq
MIRT1980134	hsa-miR-520d-3p	CLIP-seq
MIRT1980135	hsa-miR-520e	CLIP-seq
MIRT1980136	hsa-miR-520g	CLIP-seq
MIRT1980137	hsa-miR-520h	CLIP-seq
MIRT946171	hsa-miR-575	CLIP-seq
MIRT946173	hsa-miR-640	CLIP-seq
MIRT1980138	hsa-miR-720	CLIP-seq
MIRT1980139	hsa-miR-93	CLIP-seq
MIRT1980107	hsa-miR-106a	CLIP-seq
MIRT1980108	hsa-miR-106b	CLIP-seq
MIRT946116	hsa-miR-1193	CLIP-seq
MIRT946118	hsa-miR-1288	CLIP-seq
MIRT946120	hsa-miR-1307	CLIP-seq
MIRT1980110	hsa-miR-139-3p	CLIP-seq
MIRT1980112	hsa-miR-17	CLIP-seq
MIRT946125	hsa-miR-1976	CLIP-seq
MIRT1980113	hsa-miR-20a	CLIP-seq
MIRT1980114	hsa-miR-20b	CLIP-seq
MIRT946129	hsa-miR-2276	CLIP-seq
MIRT946130	hsa-miR-2392	CLIP-seq
MIRT1980115	hsa-miR-2467-3p	CLIP-seq
MIRT1980116	hsa-miR-302a	CLIP-seq
MIRT1980117	hsa-miR-302b	CLIP-seq
MIRT1980118	hsa-miR-302c	CLIP-seq
MIRT1980119	hsa-miR-302d	CLIP-seq
MIRT1980120	hsa-miR-302e	CLIP-seq
MIRT946132	hsa-miR-3199	CLIP-seq
MIRT1980122	hsa-miR-372	CLIP-seq
MIRT1980123	hsa-miR-373	CLIP-seq
MIRT946138	hsa-miR-4252	CLIP-seq
MIRT946139	hsa-miR-4258	CLIP-seq
MIRT946140	hsa-miR-4279	CLIP-seq
MIRT1980124	hsa-miR-4294	CLIP-seq
MIRT946143	hsa-miR-4418	CLIP-seq
MIRT2215297	hsa-miR-4426	CLIP-seq
MIRT946144	hsa-miR-4438	CLIP-seq
MIRT2215298	hsa-miR-4647	CLIP-seq
MIRT946147	hsa-miR-4662a-5p	CLIP-seq
MIRT2215299	hsa-miR-4662b	CLIP-seq
MIRT946148	hsa-miR-4676-5p	CLIP-seq
MIRT946149	hsa-miR-4707-3p	CLIP-seq
MIRT946152	hsa-miR-4722-3p	CLIP-seq
MIRT946153	hsa-miR-4735-5p	CLIP-seq
MIRT946154	hsa-miR-4740-3p	CLIP-seq
MIRT946155	hsa-miR-4743	CLIP-seq
MIRT946156	hsa-miR-4754	CLIP-seq
MIRT946158	hsa-miR-4775	CLIP-seq
MIRT946160	hsa-miR-509-3-5p	CLIP-seq
MIRT946161	hsa-miR-5095	CLIP-seq
MIRT946162	hsa-miR-509-5p	CLIP-seq
MIRT946163	hsa-miR-5096	CLIP-seq
MIRT1980130	hsa-miR-519d	CLIP-seq
MIRT1980131	hsa-miR-520a-3p	CLIP-seq
MIRT1980132	hsa-miR-520b	CLIP-seq
MIRT1980133	hsa-miR-520c-3p	CLIP-seq
MIRT1980134	hsa-miR-520d-3p	CLIP-seq
MIRT1980135	hsa-miR-520e	CLIP-seq
MIRT1980136	hsa-miR-520g	CLIP-seq
MIRT1980137	hsa-miR-520h	CLIP-seq
MIRT946171	hsa-miR-575	CLIP-seq
MIRT946172	hsa-miR-590-3p	CLIP-seq
MIRT1980138	hsa-miR-720	CLIP-seq
MIRT1980139	hsa-miR-93	CLIP-seq
MIRT946118	hsa-miR-1288	CLIP-seq
MIRT946120	hsa-miR-1307	CLIP-seq
MIRT946129	hsa-miR-2276	CLIP-seq
MIRT946131	hsa-miR-3160-5p	CLIP-seq
MIRT946143	hsa-miR-4418	CLIP-seq
MIRT946156	hsa-miR-4754	CLIP-seq
MIRT946160	hsa-miR-509-3-5p	CLIP-seq
MIRT946162	hsa-miR-509-5p	CLIP-seq
MIRT946118	hsa-miR-1288	CLIP-seq
MIRT946120	hsa-miR-1307	CLIP-seq
MIRT1980110	hsa-miR-139-3p	CLIP-seq
MIRT946125	hsa-miR-1976	CLIP-seq
MIRT946129	hsa-miR-2276	CLIP-seq
MIRT1921459	hsa-miR-3149	CLIP-seq
MIRT1921460	hsa-miR-411	CLIP-seq
MIRT946138	hsa-miR-4252	CLIP-seq
MIRT946139	hsa-miR-4258	CLIP-seq
MIRT946140	hsa-miR-4279	CLIP-seq
MIRT1980124	hsa-miR-4294	CLIP-seq
MIRT946143	hsa-miR-4418	CLIP-seq
MIRT946149	hsa-miR-4707-3p	CLIP-seq
MIRT946152	hsa-miR-4722-3p	CLIP-seq
MIRT946153	hsa-miR-4735-5p	CLIP-seq
MIRT946155	hsa-miR-4743	CLIP-seq
MIRT946156	hsa-miR-4754	CLIP-seq
MIRT946158	hsa-miR-4775	CLIP-seq
MIRT1921461	hsa-miR-483-5p	CLIP-seq
MIRT946160	hsa-miR-509-3-5p	CLIP-seq
MIRT946162	hsa-miR-509-5p	CLIP-seq
MIRT946172	hsa-miR-590-3p	CLIP-seq
MIRT1980138	hsa-miR-720	CLIP-seq
MIRT946118	hsa-miR-1288	CLIP-seq
MIRT1980110	hsa-miR-139-3p	CLIP-seq
MIRT1980124	hsa-miR-4294	CLIP-seq
MIRT946143	hsa-miR-4418	CLIP-seq
MIRT946155	hsa-miR-4743	CLIP-seq
MIRT946156	hsa-miR-4754	CLIP-seq
MIRT946160	hsa-miR-509-3-5p	CLIP-seq
MIRT946162	hsa-miR-509-5p	CLIP-seq
MIRT1980138	hsa-miR-720	CLIP-seq
MIRT946116	hsa-miR-1193	CLIP-seq
MIRT946118	hsa-miR-1288	CLIP-seq
MIRT946120	hsa-miR-1307	CLIP-seq
MIRT1980110	hsa-miR-139-3p	CLIP-seq
MIRT946125	hsa-miR-1976	CLIP-seq
MIRT946129	hsa-miR-2276	CLIP-seq
MIRT946130	hsa-miR-2392	CLIP-seq
MIRT1921459	hsa-miR-3149	CLIP-seq
MIRT946132	hsa-miR-3199	CLIP-seq
MIRT1921460	hsa-miR-411	CLIP-seq
MIRT946138	hsa-miR-4252	CLIP-seq
MIRT946139	hsa-miR-4258	CLIP-seq
MIRT946140	hsa-miR-4279	CLIP-seq
MIRT1980124	hsa-miR-4294	CLIP-seq
MIRT946143	hsa-miR-4418	CLIP-seq
MIRT946144	hsa-miR-4438	CLIP-seq
MIRT946147	hsa-miR-4662a-5p	CLIP-seq
MIRT946148	hsa-miR-4676-5p	CLIP-seq
MIRT946149	hsa-miR-4707-3p	CLIP-seq
MIRT946152	hsa-miR-4722-3p	CLIP-seq
MIRT946153	hsa-miR-4735-5p	CLIP-seq
MIRT946154	hsa-miR-4740-3p	CLIP-seq
MIRT946155	hsa-miR-4743	CLIP-seq
MIRT946156	hsa-miR-4754	CLIP-seq
MIRT946158	hsa-miR-4775	CLIP-seq
MIRT1921461	hsa-miR-483-5p	CLIP-seq
MIRT946160	hsa-miR-509-3-5p	CLIP-seq
MIRT946161	hsa-miR-5095	CLIP-seq
MIRT946162	hsa-miR-509-5p	CLIP-seq
MIRT946163	hsa-miR-5096	CLIP-seq
MIRT946171	hsa-miR-575	CLIP-seq
MIRT946172	hsa-miR-590-3p	CLIP-seq
MIRT1980138	hsa-miR-720	CLIP-seq
MIRT946116	hsa-miR-1193	CLIP-seq
MIRT946118	hsa-miR-1288	CLIP-seq
MIRT946120	hsa-miR-1307	CLIP-seq
MIRT1980110	hsa-miR-139-3p	CLIP-seq
MIRT946125	hsa-miR-1976	CLIP-seq
MIRT946129	hsa-miR-2276	CLIP-seq
MIRT946130	hsa-miR-2392	CLIP-seq
MIRT1921459	hsa-miR-3149	CLIP-seq
MIRT946132	hsa-miR-3199	CLIP-seq
MIRT1921460	hsa-miR-411	CLIP-seq
MIRT946138	hsa-miR-4252	CLIP-seq
MIRT946139	hsa-miR-4258	CLIP-seq
MIRT946140	hsa-miR-4279	CLIP-seq
MIRT1980124	hsa-miR-4294	CLIP-seq
MIRT946143	hsa-miR-4418	CLIP-seq
MIRT946144	hsa-miR-4438	CLIP-seq
MIRT946147	hsa-miR-4662a-5p	CLIP-seq
MIRT946148	hsa-miR-4676-5p	CLIP-seq
MIRT946149	hsa-miR-4707-3p	CLIP-seq
MIRT946152	hsa-miR-4722-3p	CLIP-seq
MIRT946153	hsa-miR-4735-5p	CLIP-seq
MIRT946154	hsa-miR-4740-3p	CLIP-seq
MIRT946155	hsa-miR-4743	CLIP-seq
MIRT946156	hsa-miR-4754	CLIP-seq
MIRT946158	hsa-miR-4775	CLIP-seq
MIRT1921461	hsa-miR-483-5p	CLIP-seq
MIRT946160	hsa-miR-509-3-5p	CLIP-seq
MIRT946161	hsa-miR-5095	CLIP-seq
MIRT946162	hsa-miR-509-5p	CLIP-seq
MIRT946163	hsa-miR-5096	CLIP-seq
MIRT946171	hsa-miR-575	CLIP-seq
MIRT946172	hsa-miR-590-3p	CLIP-seq
MIRT1980138	hsa-miR-720	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001533	Component	Cornified envelope	IEA
GO:0001533	Component	Cornified envelope	TAS
GO:0002159	Process	Desmosome assembly	IMP	9701552
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	11790773, 18343367, 22294297, 22796473, 31835537
GO:0005737	Component	Cytoplasm	IDA	22796473, 31835537
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	30949721, 31835537
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IDA	18343367
GO:0005923	Component	Bicellular tight junction	IEA
GO:0007015	Process	Actin filament organization	ISS
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0016020	Component	Membrane	IEA
GO:0030054	Component	Cell junction	IDA	22796473
GO:0030057	Component	Desmosome	IBA
GO:0030057	Component	Desmosome	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	26763450
GO:0031647	Process	Regulation of protein stability	IMP	22294297
GO:0034333	Process	Adherens junction assembly	IMP	31835537
GO:0046872	Function	Metal ion binding	IEA
GO:0046983	Function	Protein dimerization activity	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070160	Component	Tight junction	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0120192	Process	Tight junction assembly	IMP	31835537
GO:1903348	Process	Positive regulation of bicellular tight junction assembly	ISS
GO:1903753	Process	Negative regulation of p38MAPK cascade	IMP	26763450
GO:1904704	Process	Positive regulation of protein localization to adherens junction	IMP	22294297
GO:1905477	Process	Positive regulation of protein localization to membrane	IMP	31835537

MIM	HGNC	e!Ensembl
169615	3050	ENSG00000134757

P32926

Protein name

Desmoglein-3 (130 kDa pemphigus vulgaris antigen) (PVA) (Cadherin family member 6)

Protein function

A component of desmosome cell-cell junctions which are required for positive regulation of cellular adhesion (PubMed:31835537). Required for adherens and desmosome junction assembly in response to mechanical force in keratinocytes (PubMed:318355

PDB

5EQX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00028	Cadherin	57 → 148	Cadherin domain	Domain
PF00028	Cadherin	162 → 258	Cadherin domain	Domain
PF00028	Cadherin	272 → 375	Cadherin domain	Domain
PF01049	Cadherin_C	763 → 862	Cadherin cytoplasmic region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed throughout the basal and spinous layer of the epidermis with weak expression in the granular layer (at protein level) (PubMed:19717567). Expressed in skin and mucosa (at protein level) (PubMed:22294297, PubMed:30528827). Expr

Sequence

MMGLFPRTTGALAIFVVVILVHGELRIETKGQYDEEEMTMQQAKRRQKREWVKFAKPCRE
GEDNSKRNPIAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREET
PSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILN
ATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGA
DKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDN
WLAVYFFTSGNEGNWFEIQTDPRTNEGILKVVKALDYEQLQSVKLSIAVKNKAEFHQSVI
SRYRVQSTPVTIQVINVREGIAFRPASKTFTVQKGISSKKLVDYILGTYQAIDEDTNKAA
SNVKYVMGRNDGGYLMIDSKTAEIKFVKNMNRDSTFIVNKTITAEVLAIDEYTGKTSTGT
VYVRVPDFNDNCPTAVLEKDAVCSSSPSVVVSARTLNNRYTGPYTFALEDQPVKLPAVWS
ITTLNATSALLRAQEQIPPGVYHISLVLTDSQNNRCEMPRSLTLEVCQCDNRGICGTSYP
TTSPGTRYGRPHSGRLGPAAIGLLLLGLLLLLLAPLLLLTCDCGAGSTGGVTGGFIPVPD
GSEGTIHQWGIEGAHPEDKEITNICVPPVTANGADFMESSEVCTNTYARGTAVEGTSGME
MTTKLGAATESGGAAGFATGTVSGAASGFGAATGVGICSSGQSGTMRTRHSTGGTNKDYA
DGAISMNFLDSYFSQKAFACAEEDDGQEANDCLLIYDNEGADATGSPVGSVGCCSFIADD
LDDSFLDSLGPKFKKLAEISLGVDGEGKEVQPPSKDSGYGIESCGHPIEVQQTGFVKCQT
LSGSQGASALSTSGSVQPAVSIPDPLQHGNYLVTETYSASGSLVQPSTAGFDPLLTQNVI
VTERVICPISSVPGNLAGPTQLRGSHTMLCTEDPCSRLI

Sequence length

999

Interactions

View interactions

	Reactome
			Apoptotic cleavage of cell adhesion proteins Keratinization Formation of the cornified envelope

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Blistering, acantholytic, of oral and laryngeal mucosa	Pathogenic	rs1472943015	RCV001312056	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLONIC NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (77)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	16638856, 17084439, 19342368, 20878980, 31809668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	29441979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29069744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	9701552		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26469831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11021840, 11176692, 14675184, 29307572, 30239818, 31024527, 31247885, 31582719, 9540980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	27402694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31254429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	22277944, 32235430, 37511259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	35396567	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	30737471	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28526868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36375372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Diseases	Bronchial disease	Pubtator	29997230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	20713186, 28012821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38067138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31254429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17084439, 19342368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26469831, 36375372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19342368	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23106579, 31809668, 37442189, 8982400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36375372	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	24934917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15899912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	31028575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36375372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	31028575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	21177983	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	22996451, 24711455, 28300855, 31077459, 9176383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30720765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30720765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24630396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24630396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24568510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	16878157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	16878157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis Vulgaris	Ichthyosis vulgaris	Pubtator	20178468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	26597100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	16015083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	LHGDN	16015083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29969588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17084439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19342368, 23106579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	22763789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22763789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23010602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	16878157, 23737966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28526868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24630396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17084439, 19342368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31254429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20713186, 23625795, 23737966, 23752190, 24630396, 29709652, 30239818, 31582719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32869947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	22053914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	23010602, 33096435, 38067138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16878157, 23625795, 23737966, 24934917, 26469831, 30239818, 30907457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	17084439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16638856, 17084439, 23671585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30224287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33901011, 36906533, 37845218, 38330578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigoid Benign Mucous Membrane	Benign mucous membrane pemphigoid	Pubtator	22053914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	10951142, 11154866, 11776114, 12653831, 14646976, 15841178, 17101498, 19155523, 19164289, 23257250, 24102444, 25010392, 29145342, 29740444, 30179341 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	11069620, 14675184, 17392832, 18373702, 18800988, 19893475, 20093368, 20178468, 20574606, 21160493, 22053914, 22277944, 22876746, 24056861, 24646797 View all (27 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	LHGDN	12496453, 17428808, 17431647, 18586466, 18641320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	25010392, 35396567, 37940861	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	10551416, 10936030, 11120754, 11154866, 12604316, 17056584, 17640963, 18219275, 18838249, 20163452, 20178466, 22810308, 28012821, 28620161, 30910537, 31178865, 7547386, 8034325 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	10551416, 10936030, 10951142, 11021840, 11120754, 11154866, 11857336, 12496453, 12604316, 12653831, 12664033, 12878355, 14507443, 14675184, 16403096 View all (74 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	19155523, 29922278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	20178468, 22779708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	40591616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	17442983, 9701552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17431647, 19287199, 19342368, 23752190, 29069744, 31809668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24568510, 24630396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23010602, 30737471, 33096435, 38067138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	17084439, 19342368, 30239818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23625795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36375372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DSG3 (desmoglein 3)