Gene Gene information from NCBI Gene database.
Entrez ID 1821
Gene name Dystrophin related protein 2
Gene symbol DRP2
Synonyms (NCBI Gene)
DRP-2
Chromosome X
Chromosome location Xq22.1
Summary Members of the dystrophin family of proteins perform a critical role in the maintenance of membrane-associated complexes at points of intercellular contact in vertebrate cells. The protein encoded by this gene is predicted to resemble certain short C-term
SNPs SNP information provided by dbSNP.
2
SNP ID Visualize variation Clinical significance Consequence
rs753185936 G>- Likely-pathogenic Frameshift variant, coding sequence variant, 5 prime UTR variant
rs1556419606 C>T Likely-pathogenic Stop gained, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
135
miRTarBase ID miRNA Experiments Reference
MIRT497198 hsa-miR-4446-3p PAR-CLIP 22291592
MIRT497197 hsa-miR-4699-5p PAR-CLIP 22291592
MIRT497196 hsa-miR-4695-3p PAR-CLIP 22291592
MIRT497195 hsa-miR-4656 PAR-CLIP 22291592
MIRT497194 hsa-miR-7641 PAR-CLIP 22291592
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0007417 Process Central nervous system development IEA
GO:0007417 Process Central nervous system development TAS 8640231
GO:0008270 Function Zinc ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300052 3032 ENSG00000102385
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13474
Protein name Dystrophin-related protein 2 (DRP-2)
Protein function Required for normal myelination and for normal organization of the cytoplasm and the formation of Cajal bands in myelinating Schwann cells. Required for normal PRX location at appositions between the abaxonal surface of the myelin sheath and the
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00435 Spectrin 210 337 Spectrin repeat Domain
PF00397 WW 354 383 WW domain Domain
PF09068 EF-hand_2 386 504 EF hand Domain
PF09069 EF-hand_3 508 599 EF-hand Domain
PF00569 ZZ 604 648 Zinc finger, ZZ type Domain
Tissue specificity TISSUE SPECIFICITY: Detected in fetal brain. {ECO:0000269|PubMed:8640231}.
Sequence
MQPMVMQGCPYTLPRCHDWQAADQFHHSSSLRSTCPHPQVRAAVTSPAPPQDGAGVPCLS
LKLLNGSVGASGPLEPPAMNLCWNEIKKKSHNLRARLEAFSDHSGKLQLPLQEIIDWLSQ
KDEELSAQLPLQGDVALVQQEKETHAAFMEEVKSRGPYIYSVLESAQAFLSQHPFEELEE
PHSESKDTSPKQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIERTLEQLLEIQGAM
EELSTTLSQAEGVRATWEPIGDLFIDSLPEHIQAIKLFKEEFSPMKDGVKLVNDLAHQLA
ISDVHLSMENSQALEQINVRWKQLQASVSERLKQLQD
AHRDFGPGSQHFLSSSVQVPWER
AISPNKVPYYINHQAQTTCWDHP
KMTELYQTLADLNNIKFSAYRTAMKLRRVQKALRLDL
VTLTTALEIFNEHDLQASEHVMDVVEVIHCLTALYERLEEERGILVNVPLCVDMSLNWLL
NVFDSGRSGKMRALSFKTGIACLC
GTEVKEKLQYLFSQVANSGSQCDQRHLGVLLHEAIQ
VPRQLGEVAAFGGSNVEPSVRSCFRFSTGKPVIEASQFLEWVNLEPQSMVWLAVLHRVT
I
AEQVKHQTKCSICRQCPIKGFRYRSLKQFNVDICQTCFLTGRASKGNKLHYPIMEYYTPT
TSSENMRDFATTLKNKFRSKHYFSKHPQRGYLPVQSVLEADYSETPASSPMWPHADTHSR
IEHFASRLAEMESQNCSFFNDSLSPDDSIDEDQYLLRHSSPITDREPAFGQQAPCSVATE
SKGELQKILAHLEDENRILQGELRRLKWQHEEAAEAPSLADGSTEAATDHRNEELLAEAR
ILRQHKSRLETRMQILEDHNKQLESQLQRLRELLLQPPTESDGSGSAGSSLASSPQQSEG
SHPREKGQTTPDTEAADDVGSKSQDVSLCLEDIMEKLRHAFPSVRSSDVTANTLLAS
Sequence length 957
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
15
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Charcot-Marie-Tooth disease Pathogenic rs759517614 RCV005860267
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTISTIC DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Charcot-Marie-Tooth disease type X Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Charcot-Marie-Tooth disease X-linked dominant 1 Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Bipolar Disorder Bipolar Disorder BEFREE 17105906
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 31182966 Associate
★☆☆☆☆
Found in Text Mining only
Charcot-Marie-Tooth Disease Charcot-Marie-Tooth Disease BEFREE 26227883
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nonorganic psychosis Nonorganic Psychosis BEFREE 17105906
★☆☆☆☆
Found in Text Mining only
Paranoid Schizophrenia Paranoid Schizophrenia BEFREE 17105906
★☆☆☆☆
Found in Text Mining only
Polyneuropathy Polyneuropathy BEFREE 31217940
★☆☆☆☆
Found in Text Mining only
Psychotic Disorders Psychosis BEFREE 17105906
★☆☆☆☆
Found in Text Mining only
Schizophrenia Schizophrenia BEFREE 12679234, 15858820, 17105906
★☆☆☆☆
Found in Text Mining only
Shared Paranoid Disorder Shared Paranoid Disorder BEFREE 17105906
★☆☆☆☆
Found in Text Mining only