DRD5 (dopamine receptor D5)

Gene

• Entrez ID: 1816
• Gene name: Dopamine receptor D5
• Gene symbol: DRD5
• Synonyms (NCBI Gene): DBDR, DRD1B, DRD1L2
• Chromosome: 4
• Chromosome location: 4p16.1
• Summary: This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dop

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017477	hsa-miR-335-5p	Microarray	18185580
MIRT945370	hsa-miR-1253	CLIP-seq
MIRT945371	hsa-miR-3184	CLIP-seq
MIRT945372	hsa-miR-423-5p	CLIP-seq
MIRT945373	hsa-miR-4477b	CLIP-seq
MIRT945374	hsa-miR-711	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	IBA
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	IEA
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	TAS	9457173
GO:0001963	Process	Synaptic transmission, dopaminergic	NAS	11036203
GO:0001975	Process	Response to amphetamine	IEA
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IEA
GO:0001994	Process	Norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004952	Function	Dopamine neurotransmitter receptor activity	IDA	1826762
GO:0004952	Function	Dopamine neurotransmitter receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10531415, 11500503
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	1826762
GO:0005886	Component	Plasma membrane	TAS	9457173
GO:0005929	Component	Cilium	IDA	28154160
GO:0006874	Process	Intracellular calcium ion homeostasis	TAS	9457173
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	11500503
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IDA	1826762, 18403039
GO:0007212	Process	G protein-coupled dopamine receptor signaling pathway	IBA
GO:0007268	Process	Chemical synaptic transmission	NAS	7727453
GO:0007617	Process	Mating behavior	IEA
GO:0008306	Process	Associative learning	IEA
GO:0016020	Component	Membrane	IEA
GO:0019226	Process	Transmission of nerve impulse	IEA
GO:0031526	Component	Brush border membrane	IEA
GO:0033861	Process	Negative regulation of NAD(P)H oxidase activity	IDA	16352863
GO:0035240	Function	Dopamine binding	IDA	1826762
GO:0035240	Function	Dopamine binding	IEA
GO:0042060	Process	Wound healing	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0045202	Component	Synapse	IEA
GO:0045762	Process	Positive regulation of adenylate cyclase activity	NAS	7727453
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045924	Process	Regulation of female receptivity	IEA
GO:0046960	Process	Sensitization	IEA
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IEA
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	TAS	9457173
GO:0060170	Component	Ciliary membrane	IDA	20531939
GO:0060170	Component	Ciliary membrane	IEA
GO:0060292	Process	Long-term synaptic depression	IEA
GO:0071870	Process	Cellular response to catecholamine stimulus	IDA	18403039
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA
GO:0072593	Process	Reactive oxygen species metabolic process	IDA	16352863
GO:0097730	Component	Non-motile cilium	IDA	20531939
GO:0097730	Component	Non-motile cilium	IEA

Other IDs

• MIM: 126453
• HGNC: 3026
• e!Ensembl: ENSG00000169676

Protein

• UniProt ID: P21918
• Protein name: D(1B) dopamine receptor (D(5) dopamine receptor) (D1beta dopamine receptor) (Dopamine D5 receptor)
• Protein function: Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
• PDB: 8IRV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	57 → 359	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Neuron-specific, localized primarily within limbic regions of the brain. {ECO:0000269|PubMed:1834671}.
• Sequence:

  MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
  VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
  IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
  HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
  MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
  IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
  FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
  GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH

• Sequence length: 477

Pathways

KEGG:

Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Dopaminergic synapse

Reactome:

Dopamine receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER WITH HYPERACTIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN ESSENTIAL BLEPHAROSPASM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLEPHAROSPASM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRD5-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary attention deficit-hyperactivity disorder	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	11054773		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	14699430, 14732906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	11923911, 14732906, 16380908, 22562805	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	10889550, 11032390, 12377397, 14699430, 14732906, 14755441, 15108184, 15389755, 15578613, 16774975, 17501935, 18081165, 18164132, 18563476, 21832240, 21906006, 22610946, 22841130, 27250208, 27480019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	14699430, 14732906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	21906006		★☆☆☆☆ Found in Text Mining only
Benign essential blepharospasm	Benign Essential Blepharospasm	BEFREE	17133500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign essential blepharospasm	Benign Essential Blepharospasm	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	10578238, 11304828, 20874815, 24700553, 9774780		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	11304828, 9702739, 9774780		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	14708030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blepharospasm	Blepharospasm	BEFREE	11781417		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blepharospasm	Blepharospasm	CTD_human_DG	11781417		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blepharospasm	Blepharospasm	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	25556472		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25556472	Associate	★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct Disorder	BEFREE	17579368		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	14708030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Neurotic	Mental Depression	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	CTD_human_DG	14708030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Syndrome	Mental Depression	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	25896831	Associate	★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	LHGDN	14509667		★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Focal Dystonia	Focal dystonia	BEFREE	14581671, 17133500		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	9034008		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28613975, 30559168, 31702782		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30559168, 36477472	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30559168, 31702782		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28339748		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28339748	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	1532789		★☆☆☆☆ Found in Text Mining only
Lesch-Nyhan Syndrome	Lesch-Nyhan Syndrome	BEFREE	22403020		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24517546	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	9774780		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	9774780		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	9774780		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	9774780		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	9774780		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	9774780		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	9774780		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	11304828		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25556472		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30559168		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	11304828, 9583233		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	12047334		★☆☆☆☆ Found in Text Mining only
Minimal Brain Dysfunction	Minimal Brain Dysfunction	CTD_human_DG	14699430, 14732906		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28613975, 29670116, 30559168, 30984543		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29936463		★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	26808524	Inhibit	★☆☆☆☆ Found in Text Mining only
Oppositional Defiant Disorder	Oppositional Defiant Disorder	BEFREE	11054773, 17579368		★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	24668635		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11445276, 31311029		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	31311029		★☆☆☆☆ Found in Text Mining only
Psychosis, Brief Reactive	Psychosis	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	CTD_human_DG	14708030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	9686426		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizoaffective Disorder	Schizoaffective Disorder	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	9702739		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11304828, 14755441, 16459247, 18855532, 19682861, 23851595, 7633397, 8055250, 8540565, 9285966, 9702739		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia Paranoid	Schizophrenia	Pubtator	24668635	Associate	★☆☆☆☆ Found in Text Mining only
Schizophreniform Disorders	Schizophreniform Disorders	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34621500	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18322944	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	11304828		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	35544697	Associate	★☆☆☆☆ Found in Text Mining only
Wolf-Hirschhorn Syndrome	Wolf-Hirschhorn Syndrome	BEFREE	1532789		★☆☆☆☆ Found in Text Mining only