DRD2 (dopamine receptor D2)

Gene

• Entrez ID: 1813
• Gene name: Dopamine receptor D2
• Gene symbol: DRD2
• Synonyms (NCBI Gene): D2DR, D2R
• Chromosome: 11
• Chromosome location: 11q23.2
• Summary: This gene encodes the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1076560	C>A,G	Likely-benign, drug-response	Intron variant
rs1800496	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437986	hsa-miR-9-5p	Luciferase reporter assay	24675081
MIRT437986	hsa-miR-9-5p	Luciferase reporter assay	24675081
MIRT945332	hsa-miR-1285	CLIP-seq
MIRT945333	hsa-miR-1291	CLIP-seq
MIRT945334	hsa-miR-1827	CLIP-seq
MIRT945335	hsa-miR-2467-3p	CLIP-seq
MIRT945336	hsa-miR-2682	CLIP-seq
MIRT945337	hsa-miR-296-5p	CLIP-seq
MIRT945338	hsa-miR-3187-5p	CLIP-seq
MIRT945339	hsa-miR-3190	CLIP-seq
MIRT945340	hsa-miR-3202	CLIP-seq
MIRT945341	hsa-miR-326	CLIP-seq
MIRT945342	hsa-miR-330-5p	CLIP-seq
MIRT945343	hsa-miR-345	CLIP-seq
MIRT945344	hsa-miR-34a	CLIP-seq
MIRT945345	hsa-miR-34c-5p	CLIP-seq
MIRT945346	hsa-miR-378g	CLIP-seq
MIRT945347	hsa-miR-4261	CLIP-seq
MIRT945348	hsa-miR-4486	CLIP-seq
MIRT945349	hsa-miR-4490	CLIP-seq
MIRT945350	hsa-miR-449a	CLIP-seq
MIRT945351	hsa-miR-449b	CLIP-seq
MIRT945352	hsa-miR-449c	CLIP-seq
MIRT945353	hsa-miR-4533	CLIP-seq
MIRT945354	hsa-miR-4666-5p	CLIP-seq
MIRT945355	hsa-miR-4699-3p	CLIP-seq
MIRT945356	hsa-miR-4732-3p	CLIP-seq
MIRT945357	hsa-miR-4747-5p	CLIP-seq
MIRT945358	hsa-miR-4774-5p	CLIP-seq
MIRT945359	hsa-miR-4802-3p	CLIP-seq
MIRT945360	hsa-miR-512-5p	CLIP-seq
MIRT945361	hsa-miR-612	CLIP-seq
MIRT945362	hsa-miR-622	CLIP-seq
MIRT945336	hsa-miR-2682	CLIP-seq
MIRT945339	hsa-miR-3190	CLIP-seq
MIRT945363	hsa-miR-3199	CLIP-seq
MIRT945340	hsa-miR-3202	CLIP-seq
MIRT945344	hsa-miR-34a	CLIP-seq
MIRT945345	hsa-miR-34c-5p	CLIP-seq
MIRT945347	hsa-miR-4261	CLIP-seq
MIRT945364	hsa-miR-4278	CLIP-seq
MIRT945365	hsa-miR-4480	CLIP-seq
MIRT945350	hsa-miR-449a	CLIP-seq
MIRT945351	hsa-miR-449b	CLIP-seq
MIRT945352	hsa-miR-449c	CLIP-seq
MIRT945366	hsa-miR-4515	CLIP-seq
MIRT945353	hsa-miR-4533	CLIP-seq
MIRT945367	hsa-miR-4652-5p	CLIP-seq
MIRT945368	hsa-miR-4716-3p	CLIP-seq
MIRT945357	hsa-miR-4747-5p	CLIP-seq
MIRT945369	hsa-miR-9	CLIP-seq
MIRT2215049	hsa-miR-1252	CLIP-seq
MIRT2215050	hsa-miR-185	CLIP-seq
MIRT2215051	hsa-miR-3125	CLIP-seq
MIRT2215052	hsa-miR-3916	CLIP-seq
MIRT2215053	hsa-miR-4306	CLIP-seq
MIRT2215054	hsa-miR-4644	CLIP-seq
MIRT2215055	hsa-miR-4753-5p	CLIP-seq
MIRT2215056	hsa-miR-4768-3p	CLIP-seq
MIRT2519492	hsa-miR-3150b-3p	CLIP-seq
MIRT945344	hsa-miR-34a	CLIP-seq
MIRT945345	hsa-miR-34c-5p	CLIP-seq
MIRT945350	hsa-miR-449a	CLIP-seq
MIRT945351	hsa-miR-449b	CLIP-seq
MIRT2519493	hsa-miR-4689	CLIP-seq
MIRT2519494	hsa-miR-4784	CLIP-seq
MIRT2519492	hsa-miR-3150b-3p	CLIP-seq
MIRT945344	hsa-miR-34a	CLIP-seq
MIRT945345	hsa-miR-34c-5p	CLIP-seq
MIRT945350	hsa-miR-449a	CLIP-seq
MIRT945351	hsa-miR-449b	CLIP-seq
MIRT2519493	hsa-miR-4689	CLIP-seq
MIRT2519494	hsa-miR-4784	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	17317773;18354387
RELA	Unknown	17317773;18354387

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0001591	Function	Dopamine neurotransmitter receptor activity, coupled via Gi/Go	IBA
GO:0001591	Function	Dopamine neurotransmitter receptor activity, coupled via Gi/Go	IDA	2531656, 8301582
GO:0001591	Function	Dopamine neurotransmitter receptor activity, coupled via Gi/Go	IEA
GO:0001659	Process	Temperature homeostasis	IEA
GO:0001659	Process	Temperature homeostasis	ISS
GO:0001666	Process	Response to hypoxia	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001963	Process	Synaptic transmission, dopaminergic	IEA
GO:0001964	Process	Startle response	IEA
GO:0001965	Function	G-protein alpha-subunit binding	IPI	33571431
GO:0001975	Process	Response to amphetamine	IEA
GO:0001975	Process	Response to amphetamine	IEA
GO:0001975	Process	Response to amphetamine	ISS
GO:0001976	Process	Nervous system process involved in regulation of systemic arterial blood pressure	IEA
GO:0001976	Process	Nervous system process involved in regulation of systemic arterial blood pressure	ISS
GO:0002027	Process	Regulation of heart rate	IEA
GO:0002027	Process	Regulation of heart rate	ISS
GO:0002028	Process	Regulation of sodium ion transport	IEA
GO:0002028	Process	Regulation of sodium ion transport	ISS
GO:0002031	Process	G protein-coupled receptor internalization	IEA
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0002052	Process	Positive regulation of neuroblast proliferation	ISS
GO:0002092	Process	Positive regulation of receptor internalization	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004952	Function	Dopamine neurotransmitter receptor activity	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	10692483, 12297500, 17380124, 32493513
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	2531656, 8413587, 26554819
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	IDA	28154160
GO:0005929	Component	Cilium	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	7921596
GO:0006914	Process	Autophagy	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IEA
GO:0007195	Process	Adenylate cyclase-inhibiting dopamine receptor signaling pathway	IBA
GO:0007195	Process	Adenylate cyclase-inhibiting dopamine receptor signaling pathway	IDA	1331329, 2531656, 8666994, 26554819
GO:0007195	Process	Adenylate cyclase-inhibiting dopamine receptor signaling pathway	IEA
GO:0007195	Process	Adenylate cyclase-inhibiting dopamine receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	1331329
GO:0007212	Process	G protein-coupled dopamine receptor signaling pathway	IEA
GO:0007212	Process	G protein-coupled dopamine receptor signaling pathway	IEA
GO:0007270	Process	Neuron-neuron synaptic transmission	IEA
GO:0007270	Process	Neuron-neuron synaptic transmission	ISS
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0007409	Process	Axonogenesis	ISS
GO:0007416	Process	Synapse assembly	IEA
GO:0007416	Process	Synapse assembly	ISS
GO:0007608	Process	Sensory perception of smell	IEA
GO:0007608	Process	Sensory perception of smell	ISS
GO:0007616	Process	Long-term memory	IEA
GO:0007625	Process	Grooming behavior	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0007626	Process	Locomotory behavior	ISS
GO:0007628	Process	Adult walking behavior	IEA
GO:0007628	Process	Adult walking behavior	ISS
GO:0007631	Process	Feeding behavior	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008104	Process	Intracellular protein localization	ISS
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0008306	Process	Associative learning	IEA
GO:0008306	Process	Associative learning	ISS
GO:0008542	Process	Visual learning	IEA
GO:0008542	Process	Visual learning	ISS
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009410	Process	Response to xenobiotic stimulus	ISS
GO:0009416	Process	Response to light stimulus	IEA
GO:0009416	Process	Response to light stimulus	ISS
GO:0009636	Process	Response to toxic substance	IEA
GO:0010039	Process	Response to iron ion	IEA
GO:0014059	Process	Regulation of dopamine secretion	IBA
GO:0014854	Process	Response to inactivity	IEA
GO:0015459	Function	Potassium channel regulator activity	NAS	12297500
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0021756	Process	Striatum development	IEA
GO:0021769	Process	Orbitofrontal cortex development	IEA
GO:0021853	Process	Cerebral cortex GABAergic interneuron migration	IEA
GO:0021853	Process	Cerebral cortex GABAergic interneuron migration	ISS
GO:0021984	Process	Adenohypophysis development	IEA
GO:0021984	Process	Adenohypophysis development	ISS
GO:0030139	Component	Endocytic vesicle	IEA
GO:0030336	Process	Negative regulation of cell migration	ISS
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030432	Process	Peristalsis	IEA
GO:0030432	Process	Peristalsis	ISS
GO:0030534	Process	Adult behavior	IEA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0031223	Process	Auditory behavior	IEA
GO:0032228	Process	Regulation of synaptic transmission, GABAergic	IEA
GO:0032228	Process	Regulation of synaptic transmission, GABAergic	ISS
GO:0032355	Process	Response to estradiol	IEA
GO:0032467	Process	Positive regulation of cytokinesis	IMP	22888021
GO:0032795	Function	Heterotrimeric G-protein binding	IDA	33571431
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0033602	Process	Negative regulation of dopamine secretion	IEA
GO:0034776	Process	Response to histamine	IDA	16839358
GO:0035094	Process	Response to nicotine	IEA
GO:0035240	Function	Dopamine binding	IEA
GO:0035255	Function	Ionotropic glutamate receptor binding	IEA
GO:0035305	Process	Negative regulation of dephosphorylation	IEA
GO:0035556	Process	Intracellular signal transduction	IDA	1331329
GO:0035810	Process	Positive regulation of urine volume	IEA
GO:0035815	Process	Positive regulation of renal sodium excretion	IEA
GO:0036126	Component	Sperm flagellum	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042220	Process	Response to cocaine	ISS
GO:0042321	Process	Negative regulation of circadian sleep/wake cycle, sleep	IEA
GO:0042417	Process	Dopamine metabolic process	IC	8301582
GO:0042417	Process	Dopamine metabolic process	IEA
GO:0042734	Component	Presynaptic membrane	IBA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042756	Process	Drinking behavior	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	18668123, 23624386, 23637801, 28734930
GO:0043197	Component	Dendritic spine	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043266	Process	Regulation of potassium ion transport	IBA
GO:0043266	Process	Regulation of potassium ion transport	IEA
GO:0043266	Process	Regulation of potassium ion transport	IEA
GO:0043266	Process	Regulation of potassium ion transport	ISS
GO:0043278	Process	Response to morphine	IEA
GO:0043278	Process	Response to morphine	ISS
GO:0043408	Process	Regulation of MAPK cascade	IEA
GO:0043473	Process	Pigmentation	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043679	Component	Axon terminus	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IEA
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045776	Process	Negative regulation of blood pressure	ISS
GO:0045824	Process	Negative regulation of innate immune response	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046676	Process	Negative regulation of insulin secretion	IEA
GO:0046717	Process	Acid secretion	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0048148	Process	Behavioral response to cocaine	ISS
GO:0048149	Process	Behavioral response to ethanol	IEA
GO:0048149	Process	Behavioral response to ethanol	ISS
GO:0048169	Process	Regulation of long-term neuronal synaptic plasticity	IEA
GO:0048169	Process	Regulation of long-term neuronal synaptic plasticity	ISS
GO:0048678	Process	Response to axon injury	IEA
GO:0048755	Process	Branching morphogenesis of a nerve	IEA
GO:0048755	Process	Branching morphogenesis of a nerve	ISS
GO:0050482	Process	Arachidonate secretion	IDA	8301582
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050709	Process	Negative regulation of protein secretion	IDA	16839358
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050805	Process	Negative regulation of synaptic transmission	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	ISS
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0051481	Process	Negative regulation of cytosolic calcium ion concentration	IBA
GO:0051481	Process	Negative regulation of cytosolic calcium ion concentration	IEA
GO:0051580	Process	Regulation of neurotransmitter uptake	IEA
GO:0051583	Process	Dopamine uptake involved in synaptic transmission	IEA
GO:0051584	Process	Regulation of dopamine uptake involved in synaptic transmission	IC	8301582
GO:0051584	Process	Regulation of dopamine uptake involved in synaptic transmission	IEA
GO:0051586	Process	Positive regulation of dopamine uptake involved in synaptic transmission	IEA
GO:0051586	Process	Positive regulation of dopamine uptake involved in synaptic transmission	ISS
GO:0051823	Process	Regulation of synapse structural plasticity	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	NAS	21711983
GO:0051952	Process	Regulation of amine transport	IEA
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	IBA
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	IEA
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	ISS
GO:0060079	Process	Excitatory postsynaptic potential	NAS	21711983
GO:0060124	Process	Positive regulation of growth hormone secretion	IEA
GO:0060124	Process	Positive regulation of growth hormone secretion	ISS
GO:0060134	Process	Prepulse inhibition	IEA
GO:0060134	Process	Prepulse inhibition	ISS
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IBA
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IEA
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IGI	17194762
GO:0060160	Process	Negative regulation of dopamine receptor signaling pathway	IEA
GO:0060160	Process	Negative regulation of dopamine receptor signaling pathway	ISS
GO:0060170	Component	Ciliary membrane	IDA	20531939
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071361	Process	Cellular response to ethanol	IEA
GO:0090325	Process	Regulation of locomotion involved in locomotory behavior	IEA
GO:0097648	Component	G protein-coupled receptor complex	IDA	33571431
GO:0097730	Component	Non-motile cilium	IDA	20531939
GO:0098691	Component	Dopaminergic synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099170	Process	Postsynaptic modulation of chemical synaptic transmission	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:0160213	Process	Beta-arrestin-dependent dopamine receptor signaling pathway	NAS	21711983
GO:1900038	Process	Negative regulation of cellular response to hypoxia	IEA
GO:1900168	Process	Positive regulation of glial cell-derived neurotrophic factor production	IDA	23373701
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	IEA
GO:1903530	Process	Regulation of secretion by cell	IEA
GO:1990384	Process	Hyaloid vascular plexus regression	IEA
GO:1990384	Process	Hyaloid vascular plexus regression	ISS
GO:2001223	Process	Negative regulation of neuron migration	IEA

Other IDs

• MIM: 126450
• HGNC: 3023
• e!Ensembl: ENSG00000149295

Protein

• UniProt ID: P14416
• Protein name: D(2) dopamine receptor (Dopamine D2 receptor)
• Protein function: Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase (PubMed:21645528). Positively regulates postnatal regression of retinal hyaloid vessels via suppression of VEGFR2/KDR activity, downstream of OPN5 (By simi
• PDB: 5AER, 6CM4, 6LUQ, 6VMS, 7DFP, 7JVR, 8IRS, 8TZQ, 8U02
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	51 → 426	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 1]: Expressed in the anterior pituitary gland. {ECO:0000269|PubMed:2531656}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed in the anterior pituitary gland. {ECO:0000269|PubMed:2531656}.
• Sequence:

  MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
  REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
  SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
  ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
  KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
  SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
  RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
  VNPIIYTTFNIEFRKAFLKILHC

• Sequence length: 443

Pathways

KEGG:

Rap1 signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Gap junction
Dopaminergic synapse
Parkinson disease
Cocaine addiction
Alcoholism

Reactome:

Dopamine receptors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANHEDONIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER WITH HYPERACTIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL GANGLIA DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRADYCARDIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATALEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHIARI-FROMMEL SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISRUPTIVE, IMPULSE CONTROL, AND CONDUCT DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRD2-associated Dystonia	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSKINESIA, DRUG-INDUCED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSKINESIAS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSKINETIC SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dystonic disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPROLACTINEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LANGUAGE DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE WITH AURA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCLONIC DYSTONIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoclonic dystonia 11	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Benign	ClinVar CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abnormal involuntary movement	Abnormal Involuntary Movement	BEFREE	29525397		★☆☆☆☆ Found in Text Mining only
Acquired Language Disorders	Language Disorders	CTD_human_DG	23691092		★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	11174837		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30093531		★☆☆☆☆ Found in Text Mining only
Acute schizophrenia	Schizophrenia	BEFREE	24086483		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11444429, 19065655, 27185868		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	19065655		★☆☆☆☆ Found in Text Mining only
Adrenal Cortex Diseases	Adrenal Cortex Diseases	BEFREE	24618367		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	24009136, 31478179, 8027253		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	21592505		★☆☆☆☆ Found in Text Mining only
Alagille Syndrome	Alagille Syndrome	BEFREE	20002020		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19204262	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	23558112		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	9074397		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	24058526		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	PSYGENET_DG	20620876		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anhedonia	Anhedonia	Pubtator	27886638	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27578530		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	15920508, 19728374, 26808641, 28334444, 30519816		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia Nervosa	Anorexia	LHGDN	15920508		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia Nervosa	Anorexia nervosa	Pubtator	30519816	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	14643564, 17007976, 19900188, 21070510		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial personality disorder	Pubtator	23891037, 26664790, 28582390	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	11692072, 14668077, 15812318, 16632165, 17079080, 18305461, 18307984, 20122683, 20526230, 27490263, 28912499		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	12957328, 18305461, 20526230, 28969474, 31948125, 32588603, 33631331, 36078646, 9513185	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	11692072, 14668077, 15812318, 16632165, 17079080, 18305461, 18307984, 20122683, 20526230, 23835015, 25430946, 27490263, 28912499, 30946941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	18305461, 20532872		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety disorder	Pubtator	9513185	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	18305461, 20532872		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	26693483		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	31478179		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	31478179	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	1975092		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	1975092	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	34086098	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	29716536	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	17671965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	23364393		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	22832519, 24163823, 24410775, 24780147, 25271118, 26307064, 28237458, 29716536, 34853389, 35405990, 37578679	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	10578241, 10738544, 11462745, 11840503, 15802092, 17931438, 18030083, 19914781, 20446882, 21606926, 21844870, 22531292, 22610946, 22832519, 23364393, 24163823, 24410775, 24780147, 24942140, 25271118, 25641135, 25704081, 28237458, 28624582, 29169998, 30946941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	17671965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Auditory Perceptual Disorders	Auditory perceptual disorder	Pubtator	24780147	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	22559203, 24780147	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	20446882, 22559203, 23851570, 26872113		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	12898583, 22559203		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	22559203, 24453887, 28470827	Associate	★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Juvenile Parkinson Disease	Parkinson Disease	CTD_human_DG	12476322, 15469457, 9171869		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Parkinsonism	Parkinsonian disease	CTD_human_DG	12476322, 15469457, 9171869		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Parkinsonism	Parkinsonian disease	CTD_human_DG	12476322, 15469457, 9171869		★☆☆☆☆ Found in Text Mining only
Ballismus	Ballismus	CTD_human_DG	16435402		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal Ganglia Diseases	CTD_human_DG	11198054, 12211096, 18480698, 19225277, 19506579		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	32966590	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behavior Disorders	Behavior Disorders	BEFREE	1832466		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	31288722		★☆☆☆☆ Found in Text Mining only
bilateral breast cancer	Breast Cancer	BEFREE	8221639		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	10490710, 11857579, 12834818, 1385598, 18922583, 21292452, 23044341, 24229495, 25430946, 7551964, 7760324, 7903509, 7914141, 7919920, 8825888, 8950413, 9588764, 9754623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20874815, 22326841, 22514151, 23044341, 24229495		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	24229495, 27063557, 28751646, 31676688, 37252880	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	22514151		★☆☆☆☆ Found in Text Mining only
Bipolar II disorder	Bipolar Disorder	BEFREE	20577142, 22514151		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	20205808, 24157248		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	Pubtator	20205808	Associate	★☆☆☆☆ Found in Text Mining only
BORNHOLM EYE DISEASE	Bornholm Eye Disease	BEFREE	22579533		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	15542731		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	25931179	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	18698520, 24849661, 25931179, 27826691	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20180013, 29236292, 31822725		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12712467, 34979978, 40425926	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25556472	Stimulate	★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	18262320, 22579533, 22683321, 24157248, 30253082, 30677719, 31161847		★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	Pubtator	30253082	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	22683321, 24157248		★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	18981718	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	30123056	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18563706, 27121382, 30114693		★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	CTD_human_DG	1365866, 3283778, 7845605, 9618422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Catalepsy	Catalepsy	BEFREE	28516430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral atrophy	Cerebral Atrophy	BEFREE	15542731		★☆☆☆☆ Found in Text Mining only
Child Development Deviations	Development Disorder	CTD_human_DG	21592505		★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Specific	Development Disorder	CTD_human_DG	21592505		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	18366720		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	18366720		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	36043564	Associate	★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	24780147	Associate	★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	11860278, 1829682, 7936204		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	10220438		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	CTD_human_DG	19910723		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	22525159, 24078558, 26307064, 27826691, 28869277	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognitive disorder	BEFREE	26307064, 27826691, 28869277		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognitive Dysfunction	Cognition disorder	Pubtator	38359585	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16030094, 19065655, 8080720, 8707952		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19065655, 30016783	Associate	★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	BEFREE	29695928, 9222191, 9748026		★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	11860278, 1829682, 7936204		★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct Disorder	BEFREE	11236830, 19344737, 8082550		★☆☆☆☆ Found in Text Mining only
Congenital bilateral aplasia of vas deferens	Congenital bilateral absence of vas deferens	Pubtator	18305461	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	1677600		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31724271		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31478179		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	16977509		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	30973927	Associate	★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	19309018, 19739106		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Delirium	Delirium	PSYGENET_DG	19309018, 19739106		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Delusional disorder	Delusional Disorder	BEFREE	12007750, 18086475, 8837713, 9850987		★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	BEFREE	10889529, 27431292		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28869277		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	29564530, 35044623, 38359585	Associate	★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	12834818		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	11692072, 12957328, 15203798, 16632165, 17585060, 18501970, 18929622, 20526230, 23683269, 24780147, 27472173		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	12957328, 18831910, 20526230, 24780147, 30718454, 31185074, 31676688, 33631331, 37563671, 40226707, 9513185	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	20526230, 21540761, 23512949, 23683269, 24780147		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	9513185	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	CTD_human_DG	21592505		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental reading disorder	Developmental dyslexia	BEFREE	25178928		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31766642	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	31601695	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18834717, 37563671, 38034011	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	14623356, 24724616, 28374645		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	30952114		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	30935427	Associate	★☆☆☆☆ Found in Text Mining only
Disruptive Behavior Disorder	Disruptive Behavior Disorder	BEFREE	23851570		★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	23828101, 24749760, 25896831, 29716536, 32710539	Associate	★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	CTD_human_DG	17332411, 19940168, 20671181		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	22113132		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dwarfism	Dwarfism	BEFREE	31415586		★☆☆☆☆ Found in Text Mining only
Dyskinesia, Drug-Induced	Dyskinesia	CTD_human_DG	10534246, 14629710, 7845605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	10534246, 21181138, 23171335, 24633632, 28583881, 28927418, 29191473, 29525397		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyskinetic syndrome	Dyskinetic Syndrome	CTD_human_DG	16435402		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyskinetic syndrome	Dyskinetic Syndrome	LHGDN	16769201, 16959057, 17669630, 17767146		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslexia	Dyslexia	BEFREE	25178928		★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	25178928, 37667328	Associate	★☆☆☆☆ Found in Text Mining only
Dyspepsia	Dysphasia	Pubtator	25698263	Associate	★☆☆☆☆ Found in Text Mining only
Dysphoric mood	Mood Disorder	BEFREE	17079080		★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	10220438	Associate	★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	10220438, 21912682, 27696930, 28587876, 30552094, 9588625		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	16633151, 16867246, 17225991, 18922583, 19506579, 23963056		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	22683321, 24157248, 28334444, 30343042		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28331050		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36899615, 37437489	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20574053, 23260856, 25955176, 28372535		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	31330230		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	31478179		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	24737869, 29575277		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	11860278, 1829682, 7936204		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	30276840		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	29654295		★☆☆☆☆ Found in Text Mining only
Etat Marbre	Status marmoratus	CTD_human_DG	6858777		★☆☆☆☆ Found in Text Mining only
Extrapyramidal Disorders	Extrapyramidal disease	CTD_human_DG	11198054, 12211096, 18480698, 19225277, 19506579		★☆☆☆☆ Found in Text Mining only
Extrapyramidal Disorders	Extrapyramidal disease	BEFREE	16867246		★☆☆☆☆ Found in Text Mining only
Familial Juvenile Parkinsonism	Parkinsonian disease	CTD_human_DG	12476322, 15469457, 9171869		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Thyroid cancer	Pubtator	35203352	Stimulate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	19176223		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	40226707	Associate	★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	Pubtator	33462988	Associate	★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	11860278, 1829682, 7936204		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	11256581, 15094788, 16194726, 17702041, 1978653, 20431429, 2335364, 26110876, 27883923, 30192018, 7810582, 8082550, 8155017, 8725745, 9549246		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	LHGDN	15050438, 16194726		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24658464, 30953587, 31048057, 31645049		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30559168, 32830856, 33806345, 36972629	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24658464, 28486630, 30953587, 31048057, 31645049		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31456142	Associate	★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	10739171, 28927418		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31724271		★☆☆☆☆ Found in Text Mining only
Hemiballismus	Hemiballismus	CTD_human_DG	16435402		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	29992511		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	11988536, 19138335, 19853661, 22529362, 27033668, 28502806, 31822756, 9010012, 9485067		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	16366515, 9010012	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	30607746		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	11894971, 31794265		★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	CTD_human_DG	15286066, 19339912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperprolactinemia	Hyperprolactinemia	BEFREE	16169407, 19339912, 19896213, 23851570, 25955176, 26682995, 26872113, 28946556, 30967134, 31520576, 31794265		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperprolactinemia	Hyperproinsulinemia	Pubtator	16169407, 19339912, 31520576	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	25801876	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	11494094, 11894971, 15939106, 24379187, 25801876, 29654295		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	11566895		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypotension	Hypotension	Pubtator	7760324	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	BEFREE	15066159, 22525159, 24078558, 26307064, 27826691, 28869277		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	16977509		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	29369497	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	24737869		★☆☆☆☆ Found in Text Mining only
Intermittent Explosive Disorder	Intermittent Explosive Disorder	CTD_human_DG	17332411, 19940168, 20671181		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	40226707	Associate	★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	11860278, 1829682, 7936204		★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	BEFREE	23691092		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Language Disorders	Language Disorders	CTD_human_DG	23691092		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Language Disorders	Language development disorders	Pubtator	24849541	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disabilities	Learning disorders	Pubtator	19900188	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	19176223, 34440356	Associate	★☆☆☆☆ Found in Text Mining only
Lenticulostriate Disorders	Lenticulostriate Disorders	CTD_human_DG	11198054, 12211096, 18480698, 19225277, 19506579		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	30093531, 33665638	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30093531, 33665638	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30093531		★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	18831910	Associate	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	31659741		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	30348762		★☆☆☆☆ Found in Text Mining only
Lingual-Facial-Buccal Dyskinesia	Orofacial dyskinesia	CTD_human_DG	16435402		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27121382, 30123056	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	11857579, 7760324, 9588764, 9754623		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	11857579, 7760324, 7914141, 7919920, 9588764, 9754623		★☆☆☆☆ Found in Text Mining only
Major Affective Disorder 2	Major depressive disorder	Pubtator	7760324	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	11857579, 7760324, 9588764, 9754623		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	11857579, 7760324, 9588764, 9754623		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	11857579, 7760324, 9588764, 9754623		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	11857579, 7760324, 9588764, 9754623		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	11857579, 7760324, 9588764, 9754623		★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	11728608		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major depression, single episode	Mental Depression	PSYGENET_DG	11728608		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	15927089, 18929622, 22796099, 23683269, 23696934, 24555772, 25642918, 31406978, 9513185		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	22796099, 23683269, 23696934, 24322206, 24555772		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	30429454		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20180013, 29236292, 31822725		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28331050		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18563706, 27121382, 30114693		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27578530		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30204798, 31288722		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28454238		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11045783, 28454238, 28649130, 29216597, 30123056, 30131338, 30204798, 30559168, 31165782		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30123056		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	19046929		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12964006, 23947671, 8944340		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23947671	Associate	★☆☆☆☆ Found in Text Mining only
Melnick-Needles Syndrome	Melnick-Needles Syndrome	BEFREE	20305604		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	21592505		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory Disorders	Memory disorders	Pubtator	35405990	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	Pubtator	25742638	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	11692072, 12957328, 15203798, 16632165, 17585060, 18501970, 18929622, 20526230, 23683269, 24780147, 27472173		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	20526230, 21540761, 23512949, 23683269, 24780147		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	10023512, 10220438, 10402492, 10889529, 1677600, 1679742, 17446975, 19526298, 20170711, 20716857, 21150907, 21510979, 28223337, 28582390, 29716536, 31025317, 31734646, 7902708, 8723039, 9588764, 9693029		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	35893053	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	35893053	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	14623356		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29907594		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	11409701, 12497624, 12811615, 15154861, 17563839, 17970991, 20488209, 21668745, 21822697, 22290307, 22875483, 26632697, 29695928, 9222191		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	17563839	Associate	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	29695928, 9222191		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with Aura	Migraine	Pubtator	9513185	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mild cognitive disorder	Cognitive disorder	BEFREE	28869277		★☆☆☆☆ Found in Text Mining only
Minimal Brain Dysfunction	Minimal Brain Dysfunction	CTD_human_DG	17671965		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	26370377		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	16632165		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	10220438, 10402492, 10512150, 11256581, 11857579, 11992560, 15108180, 21130502, 24322206, 24655768, 8723039, 8837713, 9754623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	10220438	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	11992560, 15108180, 21130502, 24322206, 24655768		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Movement Disorders	Movement Disorders	BEFREE	11256581, 12402271, 21750899		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Movement Disorders	Movement Disorders	CTD_human_DG	6858777		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	9561979		★☆☆☆☆ Found in Text Mining only
Myoclonic dystonia	Myoclonic Dystonia	BEFREE	10220438, 10716258, 12391346, 12402271, 15258227, 17702041, 18719906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoclonic dystonia	Myoclonic dystonia	Pubtator	10220438, 15258227	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoclonic dystonia	Myoclonic Dystonia	ORPHANET_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoclonic dystonia	Myoclonic Dystonia	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoclonus-dystonia syndrome	Myoclonus-Dystonia Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31478179		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11174837, 12466351, 12964006, 18332900, 21848909, 24009136, 27519461, 27578530, 27848079, 30114693, 30123056, 30559168, 30607746, 30651332, 31478179		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	27883923	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	10634251, 11256581, 15066159, 19512960, 22875483		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10617149	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17989303		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29121220, 30200997		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	Pubtator	35721701	Associate	★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	11163121, 15812318, 21354244, 22262089		★☆☆☆☆ Found in Text Mining only
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	28120505		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17175058, 30114693		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	10719223, 15542731, 15564898, 17157291, 18351593, 19275926, 22525159, 25829376, 26114663, 26561806, 27587204, 27753212, 28416594, 29653893, 30546022, 8837713, 9779662		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10948074, 11105655, 11894971, 12497624, 14623356, 15939106, 17108814, 17907820, 22051885, 22848508, 23057570, 26445370, 27600277, 29737821, 30269448, 30343042, 31682820, 8072432, 8873216		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	12582223, 17907820, 18834717, 20561550, 22366823, 22848508, 23032305, 23670889, 23917806, 24283216, 26354923, 26445370, 27241797, 29317597, 29737821, 30269448, 35564336, 39336728, 39940809	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	26808524	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	23670889		★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	BEFREE	15457501, 7550364		★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	15121489, 16427255, 8170527, 9154247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	LHGDN	16427255		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oppositional Defiant Disorder	Oppositional Defiant Disorder	BEFREE	8725745		★☆☆☆☆ Found in Text Mining only
Oral Dyskinesia	Oral Dyskinesia	CTD_human_DG	16435402		★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	25271118	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32184581	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthropathy Primary Hypertrophic	Primary hypertrophic osteoarthropathy	Pubtator	34151861	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27578530		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27578530		★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	7485271		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	9513185	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10515181, 10634251, 10739171, 10990520, 11104188, 11256581, 11409701, 12428723, 12722176, 14622169, 15390060, 15728856, 15824260, 16124668, 17147698, 18175338, 18327668, 19396436, 19512960, 19669131, 21663922, 21781348, 22113132, 22507762, 23171335, 23439215, 24749760, 24892887, 26627941, 27190009, 27757834, 27817855, 27893588, 28687316, 28869277, 29107444, 29249680, 29434188, 29466326, 29786071, 29908325, 30200997, 30353564, 30497067, 30604007, 31235613, 31340557, 31517853, 31659741, 31816341		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	10990520, 17147698, 19476502, 21663922, 24749760, 25896831, 26961748, 28869277, 29249680, 29466326, 29541577	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	33348472	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	8558425		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	CTD_human_DG	12476322, 15469457, 9171869		★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	18389501, 35411010	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	17147698, 31659741		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	CTD_human_DG	12476322, 15469457, 9171869		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonism, Juvenile	Parkinsonian disease	CTD_human_DG	12476322, 15469457, 9171869		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	23057570, 24283216, 30269448		★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	BEFREE	11494094		★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	26872113		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	24009136, 31478179, 8027253		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	31478179	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	CTD_human_DG	12727942		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	27185868		★☆☆☆☆ Found in Text Mining only
Pituitary carcinoma	Pituitary carcinoma	CTD_human_DG	12727942		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	CTD_human_DG	12727942		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	15126577, 16216913, 18367633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	25027022, 25536318	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37563671	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	10088049, 11256581, 12217937, 12957328, 16632165, 18833581, 20554017, 23103549, 23647975, 26002549, 26363619, 26986136, 28257413, 29760667, 30983408, 31291235, 31848444, 8874837		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28869277		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	11174837, 11818506, 12972179, 16169407, 18332900, 18426817, 18791324, 20411477, 22127489, 22348806, 23740147, 25921430, 27185868, 27488872, 27848079, 30799513, 7907340		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	LHGDN	11818506		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30204798, 31288722		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30204798	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	10719223, 10889529, 15542731, 15564898, 15728856, 17157291, 18351593, 18957051, 19275926, 22525159, 24682224, 25829376, 26114663, 26561806, 27587204, 27753212, 28416594, 28542034, 29653893, 30546022, 8837713, 9779662		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	22525159, 24682224, 27886638, 30546022, 31676688, 37015728	Associate	★☆☆☆☆ Found in Text Mining only
Ramsay Hunt Paralysis Syndrome	Ramsay Hunt Paralysis Syndrome	CTD_human_DG	12476322, 15469457, 9171869		★☆☆☆☆ Found in Text Mining only
Recurrent depression	Mental Depression	BEFREE	1385598		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Recurrent depression	Mental Depression	PSYGENET_DG	1385598		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Refractory anemias	Anemia	BEFREE	20885005		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31478179		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	16941469, 18451638, 31235613, 31816341		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29321761		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20885005, 26693483		★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	23512949, 8439241		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10220012, 10402492, 10541004, 10719223, 10898926, 11131175, 11245917, 11256581, 11304833, 11343865, 11343878, 11505224, 11740982, 11803529, 11929577, 12192613, 12210271, 12399954, 12497614, 12617772, 12707934, 12942993, 14572625, 14593428, 14741327, 1475034, 15048055, 15051179, 15108180, 15211624, 15286066, 15567074, 15694263, 15802092, 15809404, 15850500, 15952869, 16183199, 16402354, 16513877, 1677600, 16867246, 16959057, 16973280, 17087792, 17092971, 17105675, 17113268, 17157291, 17207969, 17362435, 17366345, 17417059, 17455212, 17982252, 18175338, 18255274, 18332877, 1837284, 18426314, 18451638, 18496209, 18715757, 18829695, 18831910, 18855532, 18922583, 18926547, 18957051, 19158809, 19207030, 19393294, 19508883, 19512960, 19547807, 19634929, 19766158, 19913597, 19929252, 20138949, 20179754, 20194480, 20375926, 20579747, 20664489, 20665240, 2069495, 20716857, 20874815, 21206399, 21861710, 22198450, 22370928, 22525159, 22569179, 23066770, 23364393, 23512949, 23816932, 24086483, 24120301, 24322206, 24495967, 24675081, 24704945, 25056061, 25240594, 25504812, 25829376, 26320194, 26346037, 26347318, 26561806, 26598739, 26666695, 27254804, 27269479, 27283386, 27333159, 27431292, 27449010, 27578530, 27580934, 27591410, 27645107, 27756689, 27829443, 27837920, 28085950, 28094812, 28094815, 28104410, 28179504, 28252452, 28416594, 28454051, 28485732, 28507321, 28523234, 28692863, 28926871, 28981847, 29107444, 29155803, 29444518, 29627696, 29930225, 29945153, 30295716, 30332506, 30389402, 30528973, 30546022, 30604007, 30657260, 31054090, 31176829, 31291870, 31340894, 31406978, 31811028, 7480434, 7712120, 7824680, 7907680, 7914079, 7984046, 8277546, 8439241, 8471125, 8710185, 8723039, 8723049, 8825888, 8837713, 8837714, 8886166, 8908411, 9097961, 9187010, 9259374, 9472122, 9514583, 9588764, 9636132, 9650635, 9713903, 9850987, 9858029		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	CTD_human_DG	10831489, 11245917, 18583979, 21187413		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	LHGDN	12210271, 12399954, 14509080, 15211624, 15696493, 15850500, 16183199, 16769201, 16973280, 17092971, 17105675, 17113268, 17362435, 17417059, 17669630, 17681085, 18255274, 18418366, 18496209, 18829695		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	Pubtator	15920292, 18831910, 19204262, 22525159, 24636783, 27021555, 27241797, 27254804, 28548579, 29032150, 29791666, 30546022, 34853389, 35062349, 35893053, 36319771, 36641432	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophreniform Disorders	Schizophreniform Disorders	BEFREE	26561806		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	23238469	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe depression	Mental Depression	BEFREE	18929622		★☆☆☆☆ Found in Text Mining only
Sexual Dysfunction	Sexual Dysfunction	BEFREE	21749219		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	11860278, 1829682, 7936204		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	28393838, 29167485	Associate	★☆☆☆☆ Found in Text Mining only
Spinal cord myoclonus	Spinal Cord Myoclonus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spondylo-ocular syndrome	Spondyloocular Syndrome	BEFREE	15390060		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16850143		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29575277		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28454238		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31164161	Associate	★☆☆☆☆ Found in Text Mining only
Substance Withdrawal Syndrome	Substance abuse	Pubtator	23238469	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	31144779		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	11860278, 1829682, 7936204		★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	27883923	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tremor	Tremor	Pubtator	22615781	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	26790671		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	22796099, 23683269, 23696934, 24322206, 24555772		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	23683269, 23696934, 24555772, 25642918, 31406978, 9513185		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19842028	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	19176223		★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	27825895		★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	11860278, 1829682, 7936204		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	35544697	Associate	★☆☆☆☆ Found in Text Mining only
Writer`s Cramp	Writer`s Cramp	HPO_DG			★☆☆☆☆ Found in Text Mining only