DRD1 (dopamine receptor D1)

Gene

• Entrez ID: 1812
• Gene name: Dopamine receptor D1
• Gene symbol: DRD1
• Synonyms (NCBI Gene): D1R, DADR, DRD1A
• Chromosome: 5
• Chromosome location: 5q35.2
• Summary: This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases.

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000044	hsa-miR-504-5p	Luciferase reporter assay	19135651
MIRT000044	hsa-miR-504-5p	Luciferase reporter assay	19135651
MIRT438103	hsa-miR-382-5p	Luciferase reporter assay	23873704
MIRT438103	hsa-miR-382-5p	Luciferase reporter assay	23873704
MIRT736201	hsa-miR-15a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31858826
MIRT945293	hsa-miR-103a	CLIP-seq
MIRT945294	hsa-miR-106a	CLIP-seq
MIRT945295	hsa-miR-106b	CLIP-seq
MIRT945296	hsa-miR-107	CLIP-seq
MIRT945297	hsa-miR-142-5p	CLIP-seq
MIRT945298	hsa-miR-15a	CLIP-seq
MIRT945299	hsa-miR-15b	CLIP-seq
MIRT945300	hsa-miR-16	CLIP-seq
MIRT945301	hsa-miR-17	CLIP-seq
MIRT945302	hsa-miR-195	CLIP-seq
MIRT945303	hsa-miR-20a	CLIP-seq
MIRT945304	hsa-miR-20b	CLIP-seq
MIRT945305	hsa-miR-302a	CLIP-seq
MIRT945306	hsa-miR-302b	CLIP-seq
MIRT945307	hsa-miR-302c	CLIP-seq
MIRT945308	hsa-miR-302d	CLIP-seq
MIRT945309	hsa-miR-302e	CLIP-seq
MIRT945310	hsa-miR-330-3p	CLIP-seq
MIRT945311	hsa-miR-340	CLIP-seq
MIRT945312	hsa-miR-3609	CLIP-seq
MIRT945313	hsa-miR-372	CLIP-seq
MIRT945314	hsa-miR-373	CLIP-seq
MIRT945315	hsa-miR-3977	CLIP-seq
MIRT945316	hsa-miR-424	CLIP-seq
MIRT945317	hsa-miR-4435	CLIP-seq
MIRT945318	hsa-miR-4694-3p	CLIP-seq
MIRT945319	hsa-miR-4796-3p	CLIP-seq
MIRT945320	hsa-miR-497	CLIP-seq
MIRT945321	hsa-miR-519d	CLIP-seq
MIRT945322	hsa-miR-520a-3p	CLIP-seq
MIRT945323	hsa-miR-520b	CLIP-seq
MIRT945324	hsa-miR-520c-3p	CLIP-seq
MIRT945325	hsa-miR-520d-3p	CLIP-seq
MIRT945326	hsa-miR-520d-5p	CLIP-seq
MIRT945327	hsa-miR-520e	CLIP-seq
MIRT945328	hsa-miR-522	CLIP-seq
MIRT945329	hsa-miR-524-5p	CLIP-seq
MIRT945330	hsa-miR-548ah	CLIP-seq
MIRT945331	hsa-miR-93	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TFAP2B	Unknown	10640692

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	IBA
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	IDA	2144334, 2168520
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	IEA
GO:0001588	Function	Dopamine neurotransmitter receptor activity, coupled via Gs	IMP	1282671, 7838121
GO:0001659	Process	Temperature homeostasis	IEA
GO:0001661	Process	Conditioned taste aversion	IEA
GO:0001662	Process	Behavioral fear response	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001963	Process	Synaptic transmission, dopaminergic	IEA
GO:0001965	Function	G-protein alpha-subunit binding	IPI	33571431
GO:0001975	Process	Response to amphetamine	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004952	Function	Dopamine neurotransmitter receptor activity	IDA	1831904
GO:0004952	Function	Dopamine neurotransmitter receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	15569306, 27460146, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	2144334
GO:0005886	Component	Plasma membrane	IDA	11500503, 15569306
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	IDA	28154160
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006936	Process	Muscle contraction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IDA	1282671
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	2144334, 11500503
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IDA	1282671, 2144334, 2168520, 7838121, 17760784, 18403039
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IEA
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IMP	33571431
GO:0007212	Process	G protein-coupled dopamine receptor signaling pathway	IBA
GO:0007212	Process	G protein-coupled dopamine receptor signaling pathway	IEA
GO:0007416	Process	Synapse assembly	ISS
GO:0007612	Process	Learning	IEA
GO:0007613	Process	Memory	IEA
GO:0007617	Process	Mating behavior	IEA
GO:0007617	Process	Mating behavior	ISS
GO:0007625	Process	Grooming behavior	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0007628	Process	Adult walking behavior	IEA
GO:0007628	Process	Adult walking behavior	ISS
GO:0007631	Process	Feeding behavior	IEA
GO:0008306	Process	Associative learning	IEA
GO:0008542	Process	Visual learning	IEA
GO:0008542	Process	Visual learning	ISS
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009410	Process	Response to xenobiotic stimulus	ISS
GO:0012505	Component	Endomembrane system	IEA
GO:0014002	Process	Astrocyte development	IEA
GO:0015872	Process	Dopamine transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0019226	Process	Transmission of nerve impulse	IEA
GO:0019226	Process	Transmission of nerve impulse	ISS
GO:0019228	Process	Neuronal action potential	IEA
GO:0021542	Process	Dentate gyrus development	IEA
GO:0021756	Process	Striatum development	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021853	Process	Cerebral cortex GABAergic interneuron migration	IEA
GO:0021853	Process	Cerebral cortex GABAergic interneuron migration	ISS
GO:0030335	Process	Positive regulation of cell migration	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030432	Process	Peristalsis	IEA
GO:0032795	Function	Heterotrimeric G-protein binding	IDA	33571431
GO:0035106	Process	Operant conditioning	IEA
GO:0035240	Function	Dopamine binding	IEA
GO:0035240	Function	Dopamine binding	IMP	1282671
GO:0035249	Process	Synaptic transmission, glutamatergic	IEA
GO:0042053	Process	Regulation of dopamine metabolic process	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0042417	Process	Dopamine metabolic process	IC	8301582
GO:0042711	Process	Maternal behavior	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043268	Process	Positive regulation of potassium ion transport	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046323	Process	D-glucose import	IEA
GO:0046959	Process	Habituation	IEA
GO:0046960	Process	Sensitization	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	1282671, 7838121
GO:0051584	Process	Regulation of dopamine uptake involved in synaptic transmission	IC	8301582
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	ISS
GO:0060134	Process	Prepulse inhibition	ISS
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IDA	1282671
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IEA
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IEA
GO:0060170	Component	Ciliary membrane	IDA	20531939
GO:0060170	Component	Ciliary membrane	IEA
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060292	Process	Long-term synaptic depression	IEA
GO:0071870	Process	Cellular response to catecholamine stimulus	IDA	18403039
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA
GO:0097648	Component	G protein-coupled receptor complex	IMP	33571431
GO:0097730	Component	Non-motile cilium	IDA	20531939
GO:0097730	Component	Non-motile cilium	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099010	Process	Modification of postsynaptic structure	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:1990763	Function	Arrestin family protein binding	IPI	33571431
GO:2001224	Process	Positive regulation of neuron migration	IEA

Other IDs

• MIM: 126449
• HGNC: 3020
• e!Ensembl: ENSG00000184845

Protein

• UniProt ID: P21728
• Protein name: D(1A) dopamine receptor (Dopamine D1 receptor)
• Protein function: Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
• PDB: 7CKW, 7CKX, 7CKY, 7CKZ, 7CRH, 7F0T, 7F1O, 7F1Z, 7F23, 7F24, 7JOZ, 7JV5, 7JVP, 7JVQ, 7LJC, 7LJD, 7X2C, 7X2D, 7X2F, 8IRR, 8JXR, 8JXS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	40 → 331	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in caudate, nucleus accumbens and in the olfactory tubercle. {ECO:0000269|PubMed:2144334}.
• Sequence:

  MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
  FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
  RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
  ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
  CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
  GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
  VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
  SVILDYDTDVSLEKIQPITQNGQHPT

• Sequence length: 446

Pathways

KEGG:

Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Gap junction
Dopaminergic synapse
Parkinson disease
Cocaine addiction
Amphetamine addiction
Morphine addiction
Alcoholism

Reactome:

Dopamine receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATALEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSKINESIA, DRUG-INDUCED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenal Cortex Diseases	Adrenal Cortex Diseases	BEFREE	24618367		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	11723200		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29321592, 31413143		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30500462		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30500462		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	31478179		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	24410775, 28237458	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	12377397, 14569274, 15717291, 17310237, 17679637, 22404661, 24410775, 28237458, 9603612		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	LHGDN	15717291		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	18205172		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	LHGDN	18205172		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	18205172		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	26337060		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	31288722		★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	36441110	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	12488059, 1385598, 15704231, 15952869, 16397404, 17066478, 23042374, 24322206, 25233244, 8837716		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	16397404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	19153942		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	19647327, 20874815, 23042374, 24322206, 25233244		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	28751646	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	25233244		★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	24618367	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	31123752	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25556472		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25556472	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	Pubtator	37268414	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34212175	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25281486		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31478179	Associate	★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	CTD_human_DG	1365866, 3283778, 7845605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	27689550		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	18366720		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	18366720		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	1451735, 1829682		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	24078558	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	24322206		★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	1451735, 1829682		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	20503325		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31478179		★☆☆☆☆ Found in Text Mining only
Degenerative brain disorder	Degenerative Brain Disorder	BEFREE	8172940		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	19153942		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	17851196, 20685009, 23668904		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	20685009, 23668904, 27472173, 29434375		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	23133444	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34495077	Associate	★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	25896831	Associate	★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	17394052		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	31415586		★☆☆☆☆ Found in Text Mining only
Dyskinesia, Drug-Induced	Dyskinesia	CTD_human_DG	10858612, 16982285, 19520364, 7845605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	10534246, 21181138, 23041629, 29191473, 30261284, 31119645		★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	24768614, 30100364		★☆☆☆☆ Found in Text Mining only
Early onset schizophrenia	Schizophrenia	BEFREE	20382433		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37437489	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	31478179		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	1451735, 1829682		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	10948075, 15607627, 21797797		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	21797797, 28579604, 34495077	Associate	★☆☆☆☆ Found in Text Mining only
Etat Marbre	Status marmoratus	CTD_human_DG	6858777		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	19176223		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	30103756	Associate	★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	1451735, 1829682		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	15564897, 8434661, 9603612		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36477472	Associate	★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	11723200		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	8172940		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	23133444	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10447790, 15607627, 26667412, 26730182, 28770955		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	15607627		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	BEFREE	24078558, 24322206, 25233244, 30660614		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	1451735, 1829682		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	19675531	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal dystonia	Laryngeal dystonia	BEFREE	29087445		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	31613384		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25281486	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	16397404, 8837716		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	16397404, 7485250, 8837716		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	16397404, 8837716		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	16397404, 8837716		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	16397404, 8837716		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	16397404, 8837716		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	16397404, 8837716		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	24322206, 24927283		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25556472		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25281486		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31288722		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	22243760		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	19153942		★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	19153942		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31478179		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31478179	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	8869066		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	17851196, 20685009, 23668904		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	20685009, 27472173, 29434375		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	29518542		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24550737		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	17066478, 24322206		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	CTD_human_DG	6858777		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	22277051		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	28431434		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31478179		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31669811		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29121220		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	23903073		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	11176958, 11723200, 16594948, 21178390, 26957229, 27753212, 9779662		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24550737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	9603612		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32184581	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	15722953, 18832011		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11245931, 23063686, 27460146, 29478239, 30500462, 31311029, 31626851		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	25896831, 32817461, 33348472	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	28057070	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	8558425		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	31311029		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	29175512		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31288722		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	11176958, 11723200, 16594948, 21178390, 26957229, 27753212, 9779662		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	11723200	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37268414	Associate	★☆☆☆☆ Found in Text Mining only
Recurrent depression	Mental Depression	BEFREE	1385598		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Recurrent depression	Mental Depression	PSYGENET_DG	1385598		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31478179		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10206227, 15785860, 15952869, 16397404, 16984965, 17092969, 17455212, 18855532, 20081237, 20127886, 20382433, 20456319, 21178390, 21181138, 21955727, 22940547, 23036699, 23042374, 24322206, 25179995, 26213377, 26484506, 26957229, 27591410, 27996211, 7485254, 8837716		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	16397404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	18583979		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	29032150	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seminoma	Seminoma	BEFREE	22243760		★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	BEFREE	16594948		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	1451735, 1829682		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	20685009		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16850143		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	1451735, 1829682		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	24322206		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	19176223		★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	1451735, 1829682		★☆☆☆☆ Found in Text Mining only