Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1809
Gene name	Dihydropyrimidinase like 3
Gene symbol	DPYSL3
Synonyms (NCBI Gene)	CRMP-4CRMP4DRP-3DRP3LCRMPULIPULIP-1
Chromosome	5
Chromosome location	5q32

129

Show/Hide all (129)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004195	hsa-miR-197-3p	Microarray	16822819
MIRT020059	hsa-miR-375	Microarray	20215506
MIRT030031	hsa-miR-26b-5p	Microarray	19088304
MIRT042483	hsa-miR-423-3p	CLASH	23622248
MIRT720289	hsa-miR-5586-5p	HITS-CLIP	19536157
MIRT720288	hsa-miR-4738-5p	HITS-CLIP	19536157
MIRT720287	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT720286	hsa-miR-4297	HITS-CLIP	19536157
MIRT720285	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT720284	hsa-miR-155-3p	HITS-CLIP	19536157
MIRT720283	hsa-miR-3685	HITS-CLIP	19536157
MIRT720289	hsa-miR-5586-5p	HITS-CLIP	19536157
MIRT720288	hsa-miR-4738-5p	HITS-CLIP	19536157
MIRT720287	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT720286	hsa-miR-4297	HITS-CLIP	19536157
MIRT720285	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT720284	hsa-miR-155-3p	HITS-CLIP	19536157
MIRT720283	hsa-miR-3685	HITS-CLIP	19536157
MIRT440776	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440776	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT720289	hsa-miR-5586-5p	HITS-CLIP	19536157
MIRT720288	hsa-miR-4738-5p	HITS-CLIP	19536157
MIRT720287	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT720286	hsa-miR-4297	HITS-CLIP	19536157
MIRT720285	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT720284	hsa-miR-155-3p	HITS-CLIP	19536157
MIRT720283	hsa-miR-3685	HITS-CLIP	19536157
MIRT720289	hsa-miR-5586-5p	HITS-CLIP	19536157
MIRT720288	hsa-miR-4738-5p	HITS-CLIP	19536157
MIRT720287	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT720286	hsa-miR-4297	HITS-CLIP	19536157
MIRT720285	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT720284	hsa-miR-155-3p	HITS-CLIP	19536157
MIRT720283	hsa-miR-3685	HITS-CLIP	19536157
MIRT945023	hsa-miR-103a	CLIP-seq
MIRT945024	hsa-miR-107	CLIP-seq
MIRT738374	hsa-miR-1255a	CLIP-seq
MIRT738375	hsa-miR-1255b	CLIP-seq
MIRT738379	hsa-miR-1266	CLIP-seq
MIRT945025	hsa-miR-1273f	CLIP-seq
MIRT945026	hsa-miR-141	CLIP-seq
MIRT945027	hsa-miR-143	CLIP-seq
MIRT945028	hsa-miR-15a	CLIP-seq
MIRT945029	hsa-miR-15b	CLIP-seq
MIRT945030	hsa-miR-16	CLIP-seq
MIRT945031	hsa-miR-192	CLIP-seq
MIRT945032	hsa-miR-195	CLIP-seq
MIRT945033	hsa-miR-200a	CLIP-seq
MIRT945034	hsa-miR-215	CLIP-seq
MIRT945035	hsa-miR-2278	CLIP-seq
MIRT738381	hsa-miR-3158-3p	CLIP-seq
MIRT945036	hsa-miR-320e	CLIP-seq
MIRT738380	hsa-miR-3664-3p	CLIP-seq
MIRT945037	hsa-miR-3936	CLIP-seq
MIRT945038	hsa-miR-3942-3p	CLIP-seq
MIRT738382	hsa-miR-3978	CLIP-seq
MIRT945039	hsa-miR-424	CLIP-seq
MIRT945040	hsa-miR-4263	CLIP-seq
MIRT738377	hsa-miR-4270	CLIP-seq
MIRT945041	hsa-miR-4427	CLIP-seq
MIRT738376	hsa-miR-4441	CLIP-seq
MIRT738378	hsa-miR-4518	CLIP-seq
MIRT945042	hsa-miR-4521	CLIP-seq
MIRT945043	hsa-miR-4680-3p	CLIP-seq
MIRT945044	hsa-miR-4708-5p	CLIP-seq
MIRT945045	hsa-miR-4762-5p	CLIP-seq
MIRT945046	hsa-miR-4765	CLIP-seq
MIRT945047	hsa-miR-4770	CLIP-seq
MIRT945048	hsa-miR-488	CLIP-seq
MIRT945049	hsa-miR-497	CLIP-seq
MIRT945050	hsa-miR-513a-3p	CLIP-seq
MIRT945051	hsa-miR-583	CLIP-seq
MIRT945052	hsa-miR-590-3p	CLIP-seq
MIRT945053	hsa-miR-1178	CLIP-seq
MIRT945054	hsa-miR-1323	CLIP-seq
MIRT945055	hsa-miR-4700-3p	CLIP-seq
MIRT945056	hsa-miR-513a-5p	CLIP-seq
MIRT945057	hsa-miR-548a-3p	CLIP-seq
MIRT945058	hsa-miR-548e	CLIP-seq
MIRT945059	hsa-miR-548f	CLIP-seq
MIRT945060	hsa-miR-548o	CLIP-seq
MIRT738384	hsa-miR-1243	CLIP-seq
MIRT738374	hsa-miR-1255a	CLIP-seq
MIRT738375	hsa-miR-1255b	CLIP-seq
MIRT738379	hsa-miR-1266	CLIP-seq
MIRT738381	hsa-miR-3158-3p	CLIP-seq
MIRT738385	hsa-miR-3654	CLIP-seq
MIRT738380	hsa-miR-3664-3p	CLIP-seq
MIRT738382	hsa-miR-3978	CLIP-seq
MIRT738377	hsa-miR-4270	CLIP-seq
MIRT738376	hsa-miR-4441	CLIP-seq
MIRT738378	hsa-miR-4518	CLIP-seq
MIRT738383	hsa-miR-875-3p	CLIP-seq
MIRT1979742	hsa-miR-1254	CLIP-seq
MIRT1979743	hsa-miR-3116	CLIP-seq
MIRT1979744	hsa-miR-3176	CLIP-seq
MIRT1979745	hsa-miR-3922-3p	CLIP-seq
MIRT1979746	hsa-miR-661	CLIP-seq
MIRT1979747	hsa-miR-4711-3p	CLIP-seq
MIRT945023	hsa-miR-103a	CLIP-seq
MIRT945024	hsa-miR-107	CLIP-seq
MIRT945028	hsa-miR-15a	CLIP-seq
MIRT945029	hsa-miR-15b	CLIP-seq
MIRT945030	hsa-miR-16	CLIP-seq
MIRT2214913	hsa-miR-194	CLIP-seq
MIRT945032	hsa-miR-195	CLIP-seq
MIRT945035	hsa-miR-2278	CLIP-seq
MIRT2214914	hsa-miR-2355-5p	CLIP-seq
MIRT2214915	hsa-miR-298	CLIP-seq
MIRT945038	hsa-miR-3942-3p	CLIP-seq
MIRT945039	hsa-miR-424	CLIP-seq
MIRT2214916	hsa-miR-4286	CLIP-seq
MIRT2214917	hsa-miR-4468	CLIP-seq
MIRT2214918	hsa-miR-4656	CLIP-seq
MIRT945049	hsa-miR-497	CLIP-seq
MIRT2214919	hsa-miR-510	CLIP-seq
MIRT2214920	hsa-miR-802	CLIP-seq
MIRT2214921	hsa-miR-922	CLIP-seq
MIRT1979742	hsa-miR-1254	CLIP-seq
MIRT1979743	hsa-miR-3116	CLIP-seq
MIRT1979744	hsa-miR-3176	CLIP-seq
MIRT1979745	hsa-miR-3922-3p	CLIP-seq
MIRT1979746	hsa-miR-661	CLIP-seq
MIRT2214914	hsa-miR-2355-5p	CLIP-seq
MIRT2428342	hsa-miR-3119	CLIP-seq
MIRT2214916	hsa-miR-4286	CLIP-seq
MIRT2679483	hsa-miR-3130-3p	CLIP-seq
MIRT2679484	hsa-miR-4749-3p	CLIP-seq
MIRT2679485	hsa-miR-4793-3p	CLIP-seq

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004157	Function	Dihydropyrimidinase activity	IBA
GO:0005515	Function	Protein binding	IPI	21044950, 25416956, 28514442, 29892012, 31515488, 32296183, 33961781
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006208	Process	Pyrimidine nucleobase catabolic process	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0010977	Process	Negative regulation of neuron projection development	ISS
GO:0016787	Function	Hydrolase activity	IEA
GO:0016810	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds	IEA
GO:0016812	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides	IBA
GO:0017124	Function	SH3 domain binding	IEA
GO:0017124	Function	SH3 domain binding	ISS
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030336	Process	Negative regulation of cell migration	ISS
GO:0030426	Component	Growth cone	IEA
GO:0030426	Component	Growth cone	ISS
GO:0031005	Function	Filamin binding	IPI	25358863
GO:0031941	Component	Filamentous actin	IEA
GO:0031941	Component	Filamentous actin	ISS
GO:0035374	Function	Chondroitin sulfate binding	IEA
GO:0035374	Function	Chondroitin sulfate binding	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	ISS
GO:0042995	Component	Cell projection	IEA
GO:0044297	Component	Cell body	IEA
GO:0044297	Component	Cell body	ISS
GO:0045202	Component	Synapse	IEA
GO:0048666	Process	Neuron development	IEA
GO:0048678	Process	Response to axon injury	ISS
GO:0051017	Process	Actin filament bundle assembly	IEA
GO:0051017	Process	Actin filament bundle assembly	ISS
GO:0051219	Function	Phosphoprotein binding	IEA
GO:0051491	Process	Positive regulation of filopodium assembly	IEA
GO:0051491	Process	Positive regulation of filopodium assembly	ISS
GO:0051764	Process	Actin crosslink formation	IBA
GO:0051764	Process	Actin crosslink formation	IEA
GO:0051764	Process	Actin crosslink formation	ISS
GO:0070382	Component	Exocytic vesicle	IEA
GO:0070382	Component	Exocytic vesicle	ISS
GO:0071345	Process	Cellular response to cytokine stimulus	ISS

MIM	HGNC	e!Ensembl
601168	3015	ENSG00000113657

Q14195

Protein name

Dihydropyrimidinase-related protein 3 (DRP-3) (Collapsin response mediator protein 4) (CRMP-4) (Unc-33-like phosphoprotein 1) (ULIP-1)

Protein function

Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration (By similarity).

PDB

4BKN , 4CNS , 4CNT , 4CNU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01979	Amidohydro_1	64 → 453	Amidohydrolase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in heart and skeletal muscle. Also strongly expressed in fetal brain and spinal cord.

Sequence

MSYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEA
NGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAY
EKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTE
LYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPEGHVLSRPEELEAEAVFRAI
TIASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAA
FVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEE
RMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIV
SAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYK
RIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSL
SGTQVDEGVRSASKRIVAPPGGRSNITSLS

Sequence length

570

Interactions

View interactions

	Reactome
			CRMPs in Sema3A signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Autism	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (44)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35434133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	36180068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	29196732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	29196732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29196732, 31137494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30498031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31980687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21036680	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22797725, 29514686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37380971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29417701, 38268058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 5q Deletion Syndrome	Chromosome 5q deletion syndrome	Pubtator	9339364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33655336, 37380971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31980687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	11771764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	17711980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25173447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22797725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29514686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	29308052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30498031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22797725, 29514686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22805864, 27207309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20543870, 25338524, 25888628, 27014974, 28122909, 28382925, 28639202, 29601651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25096402, 31377880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24339867, 25096402, 25173447, 25888628, 27014974, 28639202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22805864, 25173447, 25338524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11501497, 24011394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24011394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28219123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22805864, 27207309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24339867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	27207309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	27207309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20543870, 25338524, 25888628, 28122909, 28382925, 28639202, 29601651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28651527	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 7	Spinocerebellar Ataxia	BEFREE	15325126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25096402, 31377880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25096402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37380971	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	BEFREE	12731003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30498031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37380971, 40481075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	37380971	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DPYSL3 (dihydropyrimidinase like 3)