Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	1805
Gene name	Dermatopontin
Gene symbol	DPT
Synonyms (NCBI Gene)	TRAMP
Chromosome	1
Chromosome location	1q24.2
Summary	Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the be

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs748718975	G>A	Pathogenic	Coding sequence variant, missense variant

127

Show/Hide all (127)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019412	hsa-miR-148b-3p	Microarray	17612493
MIRT944407	hsa-miR-1184	CLIP-seq
MIRT944408	hsa-miR-1205	CLIP-seq
MIRT944409	hsa-miR-1298	CLIP-seq
MIRT944410	hsa-miR-1909	CLIP-seq
MIRT944411	hsa-miR-19a	CLIP-seq
MIRT944412	hsa-miR-19b	CLIP-seq
MIRT944413	hsa-miR-3158-5p	CLIP-seq
MIRT944414	hsa-miR-3650	CLIP-seq
MIRT944415	hsa-miR-4481	CLIP-seq
MIRT944416	hsa-miR-4491	CLIP-seq
MIRT944417	hsa-miR-4657	CLIP-seq
MIRT944418	hsa-miR-4708-3p	CLIP-seq
MIRT944419	hsa-miR-4745-5p	CLIP-seq
MIRT944420	hsa-miR-4747-5p	CLIP-seq
MIRT944421	hsa-miR-4786-3p	CLIP-seq
MIRT944422	hsa-miR-544	CLIP-seq
MIRT944423	hsa-miR-671-5p	CLIP-seq
MIRT944410	hsa-miR-1909	CLIP-seq
MIRT944411	hsa-miR-19a	CLIP-seq
MIRT944412	hsa-miR-19b	CLIP-seq
MIRT1979639	hsa-miR-2964a-5p	CLIP-seq
MIRT944414	hsa-miR-3650	CLIP-seq
MIRT1979640	hsa-miR-3667-3p	CLIP-seq
MIRT944415	hsa-miR-4481	CLIP-seq
MIRT1979641	hsa-miR-4639-5p	CLIP-seq
MIRT944418	hsa-miR-4708-3p	CLIP-seq
MIRT944419	hsa-miR-4745-5p	CLIP-seq
MIRT944421	hsa-miR-4786-3p	CLIP-seq
MIRT1979642	hsa-miR-500a	CLIP-seq
MIRT944423	hsa-miR-671-5p	CLIP-seq
MIRT1979643	hsa-miR-873	CLIP-seq
MIRT1979644	hsa-miR-890	CLIP-seq
MIRT2214716	hsa-miR-1252	CLIP-seq
MIRT2214717	hsa-miR-3692	CLIP-seq
MIRT2214718	hsa-miR-4436b-5p	CLIP-seq
MIRT1979641	hsa-miR-4639-5p	CLIP-seq
MIRT1979644	hsa-miR-890	CLIP-seq
MIRT2387102	hsa-miR-2115	CLIP-seq
MIRT2387103	hsa-miR-502-5p	CLIP-seq
MIRT2387104	hsa-miR-516a-3p	CLIP-seq
MIRT2436884	hsa-miR-2355-5p	CLIP-seq
MIRT2436885	hsa-miR-3679-3p	CLIP-seq
MIRT2436886	hsa-miR-5096	CLIP-seq
MIRT2214716	hsa-miR-1252	CLIP-seq
MIRT2519163	hsa-miR-1256	CLIP-seq
MIRT2519164	hsa-miR-1266	CLIP-seq
MIRT2519165	hsa-miR-15a	CLIP-seq
MIRT2519166	hsa-miR-15b	CLIP-seq
MIRT2519167	hsa-miR-16	CLIP-seq
MIRT2519168	hsa-miR-195	CLIP-seq
MIRT2387102	hsa-miR-2115	CLIP-seq
MIRT2519169	hsa-miR-2278	CLIP-seq
MIRT2214717	hsa-miR-3692	CLIP-seq
MIRT2519170	hsa-miR-3921	CLIP-seq
MIRT2519171	hsa-miR-3923	CLIP-seq
MIRT2519172	hsa-miR-424	CLIP-seq
MIRT2519173	hsa-miR-4256	CLIP-seq
MIRT2519174	hsa-miR-4267	CLIP-seq
MIRT2519175	hsa-miR-4270	CLIP-seq
MIRT2519176	hsa-miR-4286	CLIP-seq
MIRT2519177	hsa-miR-4311	CLIP-seq
MIRT2519178	hsa-miR-4427	CLIP-seq
MIRT2519179	hsa-miR-4434	CLIP-seq
MIRT2214718	hsa-miR-4436b-5p	CLIP-seq
MIRT2519180	hsa-miR-4441	CLIP-seq
MIRT2519181	hsa-miR-4516	CLIP-seq
MIRT2519182	hsa-miR-4518	CLIP-seq
MIRT2519183	hsa-miR-4639-3p	CLIP-seq
MIRT2519184	hsa-miR-4642	CLIP-seq
MIRT2519185	hsa-miR-4653-5p	CLIP-seq
MIRT2519186	hsa-miR-4680-3p	CLIP-seq
MIRT2519187	hsa-miR-4714-3p	CLIP-seq
MIRT2519188	hsa-miR-4715-5p	CLIP-seq
MIRT2519189	hsa-miR-490-3p	CLIP-seq
MIRT2519190	hsa-miR-497	CLIP-seq
MIRT2387103	hsa-miR-502-5p	CLIP-seq
MIRT2387104	hsa-miR-516a-3p	CLIP-seq
MIRT2519191	hsa-miR-591	CLIP-seq
MIRT2519192	hsa-miR-634	CLIP-seq
MIRT2519193	hsa-miR-668	CLIP-seq
MIRT2519194	hsa-miR-922	CLIP-seq
MIRT2519195	hsa-miR-935	CLIP-seq
MIRT2214716	hsa-miR-1252	CLIP-seq
MIRT2519163	hsa-miR-1256	CLIP-seq
MIRT2519164	hsa-miR-1266	CLIP-seq
MIRT2519165	hsa-miR-15a	CLIP-seq
MIRT2519166	hsa-miR-15b	CLIP-seq
MIRT2519167	hsa-miR-16	CLIP-seq
MIRT2519168	hsa-miR-195	CLIP-seq
MIRT2387102	hsa-miR-2115	CLIP-seq
MIRT2679457	hsa-miR-216a	CLIP-seq
MIRT2679458	hsa-miR-216b	CLIP-seq
MIRT2519169	hsa-miR-2278	CLIP-seq
MIRT2679459	hsa-miR-3143	CLIP-seq
MIRT2214717	hsa-miR-3692	CLIP-seq
MIRT2519170	hsa-miR-3921	CLIP-seq
MIRT2519171	hsa-miR-3923	CLIP-seq
MIRT2519172	hsa-miR-424	CLIP-seq
MIRT2519173	hsa-miR-4256	CLIP-seq
MIRT2519174	hsa-miR-4267	CLIP-seq
MIRT2519175	hsa-miR-4270	CLIP-seq
MIRT2519176	hsa-miR-4286	CLIP-seq
MIRT2519177	hsa-miR-4311	CLIP-seq
MIRT2519178	hsa-miR-4427	CLIP-seq
MIRT2519179	hsa-miR-4434	CLIP-seq
MIRT2214718	hsa-miR-4436b-5p	CLIP-seq
MIRT2519180	hsa-miR-4441	CLIP-seq
MIRT2519181	hsa-miR-4516	CLIP-seq
MIRT2519182	hsa-miR-4518	CLIP-seq
MIRT2519183	hsa-miR-4639-3p	CLIP-seq
MIRT2519184	hsa-miR-4642	CLIP-seq
MIRT2519185	hsa-miR-4653-5p	CLIP-seq
MIRT2519186	hsa-miR-4680-3p	CLIP-seq
MIRT2679460	hsa-miR-4683	CLIP-seq
MIRT2519187	hsa-miR-4714-3p	CLIP-seq
MIRT2519188	hsa-miR-4715-5p	CLIP-seq
MIRT2679461	hsa-miR-4803	CLIP-seq
MIRT2519189	hsa-miR-490-3p	CLIP-seq
MIRT2519190	hsa-miR-497	CLIP-seq
MIRT2387103	hsa-miR-502-5p	CLIP-seq
MIRT2387104	hsa-miR-516a-3p	CLIP-seq
MIRT2519191	hsa-miR-591	CLIP-seq
MIRT2519192	hsa-miR-634	CLIP-seq
MIRT2519193	hsa-miR-668	CLIP-seq
MIRT2519194	hsa-miR-922	CLIP-seq
MIRT2519195	hsa-miR-935	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005201	Function	Extracellular matrix structural constituent	ISS
GO:0005201	Function	Extracellular matrix structural constituent	RCA	20551380, 25037231, 27068509, 27559042, 28675934
GO:0005515	Function	Protein binding	IPI	30082873
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0007155	Process	Cell adhesion	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0030199	Process	Collagen fibril organization	IBA
GO:0030199	Process	Collagen fibril organization	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	25037231, 27068509, 27559042, 28675934
GO:0031012	Component	Extracellular matrix	ISS	22261194

MIM	HGNC	e!Ensembl
125597	3011	ENSG00000143196

Q07507

Protein name

Dermatopontin (Tyrosine-rich acidic matrix protein) (TRAMP)

Protein function

Seems to mediate adhesion by cell surface integrin binding. May serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. Enhances TGFB1 activity. Inhibits cell proliferation. Accelerates

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14704	DERM	40 → 196	Dermatopontin	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in fibroblasts, heart, skeletal muscle, brain and pancreas. Expressed at an intermediate level in lung and kidney, and at a low level in liver and placenta. Expressed at a lower level in fibroblasts from hypertrophic scar les

Sequence

MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVR
SIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYF
ESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVER
DRQWKFIMCRMTEYDCEFANV

Sequence length

201

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Progressive sensorineural hearing impairment	Pathogenic	rs748718975	RCV000416574	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VARICOSE VEINS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VARICOSITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (54)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	17638871, 19701244, 27634876, 30188869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	23842593, 27980106, 28095711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	28983260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	23593175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	14679100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26357040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35819135, 36774339, 39379897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	39379897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16452231, 28197388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	25298407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	38300311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24516561, 36012487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12203941, 18556337, 21610124, 29934364, 30002199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12203941, 18556337, 21610124, 29934364, 30002199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11272162, 11393553, 12203941, 18556337, 21610124, 26357040, 29769238, 29934364, 30002199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27292155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	9779801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	27207648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	9779801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	15139000, 22425196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	25304290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	20555348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	20555348	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33536009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	15139000, 17222838	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	26776909, 29747655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	34321013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25149533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	35159124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38300311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26357040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11289132, 15678150, 15761871, 15870705, 16452231, 16899568, 16927305, 17638871, 17906287, 18649357, 18668517, 18718531, 19147983, 19351827, 19784068 View all (42 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29434905, 29923079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22761195, 24980820, 25149533, 28336087, 29450905, 29870225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere disease	Pubtator	27876815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11289132, 16278413, 16452231, 16899568, 17131319, 18668517, 19351755, 19351827, 20172545, 21586128, 21671747, 22470535, 23441198, 25149533, 25712054 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	30188869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31188872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36012487	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	29944724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29115446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36189254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	16899568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30391671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal fibrosis	Pubtator	28673451	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	27980106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11289132, 15678150, 15761871, 15870705, 16452231, 16899568, 16927305, 17638871, 17906287, 18649357, 18668517, 18718531, 19147983, 19351827, 19784068 View all (41 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	26418896, 28493878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	14751836, 15761871, 16179929, 18723670, 20609350, 21625214, 22470535, 23441198, 24980820, 27232975, 27634876, 28095711, 29861778, 31168562, 31299353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29434905, 29923079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34686626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	15139000, 22425196, 27987347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	CTD_human_DG	17643059		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	20172545		★★★★★ ★☆☆☆☆ Found in Text Mining only

DPT (dermatopontin)