DPP4 (dipeptidyl peptidase 4)

Gene

• Entrez ID: 1803
• Gene name: Dipeptidyl peptidase 4
• Gene symbol: DPP4
• Synonyms (NCBI Gene): ADABP, ADCP2, CD26, DPPIV, TP103
• Chromosome: 2
• Chromosome location: 2q24.2
• Summary: The DPP4 gene encodes dipeptidyl peptidase 4, which is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic type II transmembrane glycoprotein and a serine exopeptidase that cleaves X-proline

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT755410	hsa-let-7b-5p	qRT-PCR	36073344
MIRT944211	hsa-miR-1273g	CLIP-seq
MIRT944212	hsa-miR-1305	CLIP-seq
MIRT944213	hsa-miR-4294	CLIP-seq
MIRT944214	hsa-miR-924	CLIP-seq
MIRT944211	hsa-miR-1273g	CLIP-seq
MIRT1979585	hsa-miR-1289	CLIP-seq
MIRT944212	hsa-miR-1305	CLIP-seq
MIRT1979586	hsa-miR-3198	CLIP-seq
MIRT944213	hsa-miR-4294	CLIP-seq
MIRT1979587	hsa-miR-4309	CLIP-seq
MIRT944214	hsa-miR-924	CLIP-seq
MIRT2436875	hsa-miR-2861	CLIP-seq
MIRT2436876	hsa-miR-3193	CLIP-seq
MIRT2436877	hsa-miR-34a	CLIP-seq
MIRT2436878	hsa-miR-34c-5p	CLIP-seq
MIRT2436879	hsa-miR-4488	CLIP-seq
MIRT2436880	hsa-miR-449a	CLIP-seq
MIRT2436881	hsa-miR-449b	CLIP-seq
MIRT2436882	hsa-miR-4697-5p	CLIP-seq
MIRT2436883	hsa-miR-637	CLIP-seq
MIRT2519073	hsa-miR-1200	CLIP-seq
MIRT2519074	hsa-miR-1227	CLIP-seq
MIRT2519075	hsa-miR-1269	CLIP-seq
MIRT2519076	hsa-miR-1269b	CLIP-seq
MIRT944211	hsa-miR-1273g	CLIP-seq
MIRT1979585	hsa-miR-1289	CLIP-seq
MIRT944212	hsa-miR-1305	CLIP-seq
MIRT2519077	hsa-miR-146b-3p	CLIP-seq
MIRT2519078	hsa-miR-148a	CLIP-seq
MIRT2519079	hsa-miR-148b	CLIP-seq
MIRT2519080	hsa-miR-152	CLIP-seq
MIRT2519081	hsa-miR-153	CLIP-seq
MIRT2519082	hsa-miR-186	CLIP-seq
MIRT2519083	hsa-miR-188-5p	CLIP-seq
MIRT2519084	hsa-miR-204	CLIP-seq
MIRT2519085	hsa-miR-2052	CLIP-seq
MIRT2519086	hsa-miR-211	CLIP-seq
MIRT2519087	hsa-miR-22	CLIP-seq
MIRT2519088	hsa-miR-23a	CLIP-seq
MIRT2519089	hsa-miR-23b	CLIP-seq
MIRT2519090	hsa-miR-23c	CLIP-seq
MIRT2436875	hsa-miR-2861	CLIP-seq
MIRT2519091	hsa-miR-3074-5p	CLIP-seq
MIRT2519092	hsa-miR-3133	CLIP-seq
MIRT2519093	hsa-miR-3157-3p	CLIP-seq
MIRT2519094	hsa-miR-3160-5p	CLIP-seq
MIRT2519095	hsa-miR-3173-5p	CLIP-seq
MIRT2436876	hsa-miR-3193	CLIP-seq
MIRT1979586	hsa-miR-3198	CLIP-seq
MIRT2436877	hsa-miR-34a	CLIP-seq
MIRT2436878	hsa-miR-34c-5p	CLIP-seq
MIRT2519096	hsa-miR-3646	CLIP-seq
MIRT2519097	hsa-miR-3662	CLIP-seq
MIRT2519098	hsa-miR-3672	CLIP-seq
MIRT2519099	hsa-miR-3676	CLIP-seq
MIRT2519100	hsa-miR-3913-3p	CLIP-seq
MIRT2519101	hsa-miR-3914	CLIP-seq
MIRT2519102	hsa-miR-3940-5p	CLIP-seq
MIRT2519103	hsa-miR-4264	CLIP-seq
MIRT2519104	hsa-miR-4287	CLIP-seq
MIRT2519105	hsa-miR-4293	CLIP-seq
MIRT944213	hsa-miR-4294	CLIP-seq
MIRT1979587	hsa-miR-4309	CLIP-seq
MIRT2519106	hsa-miR-4324	CLIP-seq
MIRT2519107	hsa-miR-4328	CLIP-seq
MIRT2519108	hsa-miR-4329	CLIP-seq
MIRT2519109	hsa-miR-4330	CLIP-seq
MIRT2519110	hsa-miR-4421	CLIP-seq
MIRT2519111	hsa-miR-4446-5p	CLIP-seq
MIRT2519112	hsa-miR-4469	CLIP-seq
MIRT2519113	hsa-miR-448	CLIP-seq
MIRT2436879	hsa-miR-4488	CLIP-seq
MIRT2436880	hsa-miR-449a	CLIP-seq
MIRT2436881	hsa-miR-449b	CLIP-seq
MIRT2519114	hsa-miR-4507	CLIP-seq
MIRT2519115	hsa-miR-452	CLIP-seq
MIRT2519116	hsa-miR-4529-3p	CLIP-seq
MIRT2519117	hsa-miR-4645-3p	CLIP-seq
MIRT2519118	hsa-miR-4659a-5p	CLIP-seq
MIRT2519119	hsa-miR-4659b-5p	CLIP-seq
MIRT2519120	hsa-miR-4676-3p	CLIP-seq
MIRT2519121	hsa-miR-4685-3p	CLIP-seq
MIRT2519122	hsa-miR-4697-3p	CLIP-seq
MIRT2436882	hsa-miR-4697-5p	CLIP-seq
MIRT2519123	hsa-miR-4755-5p	CLIP-seq
MIRT2519124	hsa-miR-4768-5p	CLIP-seq
MIRT2519125	hsa-miR-4776-3p	CLIP-seq
MIRT2519126	hsa-miR-4797-3p	CLIP-seq
MIRT2519127	hsa-miR-489	CLIP-seq
MIRT2519128	hsa-miR-498	CLIP-seq
MIRT2519129	hsa-miR-499-3p	CLIP-seq
MIRT2519130	hsa-miR-499a-3p	CLIP-seq
MIRT2519131	hsa-miR-520f	CLIP-seq
MIRT2519132	hsa-miR-544b	CLIP-seq
MIRT2519133	hsa-miR-548a-3p	CLIP-seq
MIRT2519134	hsa-miR-548e	CLIP-seq
MIRT2519135	hsa-miR-548f	CLIP-seq
MIRT2519136	hsa-miR-548g	CLIP-seq
MIRT2519137	hsa-miR-570	CLIP-seq
MIRT2519138	hsa-miR-596	CLIP-seq
MIRT2519139	hsa-miR-622	CLIP-seq
MIRT2519140	hsa-miR-623	CLIP-seq
MIRT2436883	hsa-miR-637	CLIP-seq
MIRT2519141	hsa-miR-642a	CLIP-seq
MIRT2519142	hsa-miR-874	CLIP-seq
MIRT2519143	hsa-miR-888	CLIP-seq
MIRT2519144	hsa-miR-9	CLIP-seq
MIRT944214	hsa-miR-924	CLIP-seq
MIRT2519145	hsa-miR-942	CLIP-seq
MIRT2519073	hsa-miR-1200	CLIP-seq
MIRT2519075	hsa-miR-1269	CLIP-seq
MIRT2519076	hsa-miR-1269b	CLIP-seq
MIRT944211	hsa-miR-1273g	CLIP-seq
MIRT1979585	hsa-miR-1289	CLIP-seq
MIRT944212	hsa-miR-1305	CLIP-seq
MIRT2519077	hsa-miR-146b-3p	CLIP-seq
MIRT2519078	hsa-miR-148a	CLIP-seq
MIRT2519079	hsa-miR-148b	CLIP-seq
MIRT2519080	hsa-miR-152	CLIP-seq
MIRT2519081	hsa-miR-153	CLIP-seq
MIRT2519084	hsa-miR-204	CLIP-seq
MIRT2519085	hsa-miR-2052	CLIP-seq
MIRT2519086	hsa-miR-211	CLIP-seq
MIRT2519087	hsa-miR-22	CLIP-seq
MIRT2519088	hsa-miR-23a	CLIP-seq
MIRT2519089	hsa-miR-23b	CLIP-seq
MIRT2519090	hsa-miR-23c	CLIP-seq
MIRT2436875	hsa-miR-2861	CLIP-seq
MIRT2519091	hsa-miR-3074-5p	CLIP-seq
MIRT2519093	hsa-miR-3157-3p	CLIP-seq
MIRT2519094	hsa-miR-3160-5p	CLIP-seq
MIRT2519095	hsa-miR-3173-5p	CLIP-seq
MIRT2436876	hsa-miR-3193	CLIP-seq
MIRT1979586	hsa-miR-3198	CLIP-seq
MIRT2436877	hsa-miR-34a	CLIP-seq
MIRT2436878	hsa-miR-34c-5p	CLIP-seq
MIRT2679443	hsa-miR-3622b-5p	CLIP-seq
MIRT2519097	hsa-miR-3662	CLIP-seq
MIRT2519098	hsa-miR-3672	CLIP-seq
MIRT2519099	hsa-miR-3676	CLIP-seq
MIRT2519100	hsa-miR-3913-3p	CLIP-seq
MIRT2519101	hsa-miR-3914	CLIP-seq
MIRT2519102	hsa-miR-3940-5p	CLIP-seq
MIRT2519103	hsa-miR-4264	CLIP-seq
MIRT2519104	hsa-miR-4287	CLIP-seq
MIRT2519105	hsa-miR-4293	CLIP-seq
MIRT944213	hsa-miR-4294	CLIP-seq
MIRT1979587	hsa-miR-4309	CLIP-seq
MIRT2519106	hsa-miR-4324	CLIP-seq
MIRT2519107	hsa-miR-4328	CLIP-seq
MIRT2519109	hsa-miR-4330	CLIP-seq
MIRT2519110	hsa-miR-4421	CLIP-seq
MIRT2519111	hsa-miR-4446-5p	CLIP-seq
MIRT2519112	hsa-miR-4469	CLIP-seq
MIRT2519113	hsa-miR-448	CLIP-seq
MIRT2436879	hsa-miR-4488	CLIP-seq
MIRT2436880	hsa-miR-449a	CLIP-seq
MIRT2436881	hsa-miR-449b	CLIP-seq
MIRT2519114	hsa-miR-4507	CLIP-seq
MIRT2519115	hsa-miR-452	CLIP-seq
MIRT2519116	hsa-miR-4529-3p	CLIP-seq
MIRT2519117	hsa-miR-4645-3p	CLIP-seq
MIRT2519118	hsa-miR-4659a-5p	CLIP-seq
MIRT2519119	hsa-miR-4659b-5p	CLIP-seq
MIRT2519120	hsa-miR-4676-3p	CLIP-seq
MIRT2519121	hsa-miR-4685-3p	CLIP-seq
MIRT2679444	hsa-miR-4694-3p	CLIP-seq
MIRT2519122	hsa-miR-4697-3p	CLIP-seq
MIRT2436882	hsa-miR-4697-5p	CLIP-seq
MIRT2519123	hsa-miR-4755-5p	CLIP-seq
MIRT2519124	hsa-miR-4768-5p	CLIP-seq
MIRT2519125	hsa-miR-4776-3p	CLIP-seq
MIRT2519126	hsa-miR-4797-3p	CLIP-seq
MIRT2519127	hsa-miR-489	CLIP-seq
MIRT2519128	hsa-miR-498	CLIP-seq
MIRT2519129	hsa-miR-499-3p	CLIP-seq
MIRT2519130	hsa-miR-499a-3p	CLIP-seq
MIRT2519131	hsa-miR-520f	CLIP-seq
MIRT2679445	hsa-miR-522	CLIP-seq
MIRT2519132	hsa-miR-544b	CLIP-seq
MIRT2519137	hsa-miR-570	CLIP-seq
MIRT2519138	hsa-miR-596	CLIP-seq
MIRT2519140	hsa-miR-623	CLIP-seq
MIRT2436883	hsa-miR-637	CLIP-seq
MIRT2519141	hsa-miR-642a	CLIP-seq
MIRT2519142	hsa-miR-874	CLIP-seq
MIRT2519144	hsa-miR-9	CLIP-seq
MIRT944214	hsa-miR-924	CLIP-seq
MIRT2519145	hsa-miR-942	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	23486063
GO:0001662	Process	Behavioral fear response	IEA
GO:0001666	Process	Response to hypoxia	IDA	16670267
GO:0002020	Function	Protease binding	IPI	16651416
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	EXP	8100523, 8798518
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005102	Function	Signaling receptor binding	IPI	10900005
GO:0005515	Function	Protein binding	IPI	7594462, 8101391, 14684150, 17287217, 17549790, 18275857, 21314817, 22001206, 23486063, 23831647, 23835475, 25461530, 29669833, 32203189, 32275855, 34903715
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16670267
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	27198182
GO:0006508	Process	Proteolysis	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IDA	14684150
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008239	Function	Dipeptidyl-peptidase activity	IBA
GO:0008239	Function	Dipeptidyl-peptidase activity	IDA	10593948, 14684150, 16651416, 17549790, 27198182
GO:0008239	Function	Dipeptidyl-peptidase activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	17549790
GO:0009986	Component	Cell surface	IDA	7594462, 8101391, 10900005, 11772392
GO:0010716	Process	Negative regulation of extracellular matrix disassembly	IDA	16651416
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	15052268
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016486	Process	Peptide hormone processing	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0019065	Process	Receptor-mediated endocytosis of virus by host cell	NAS	23831647, 32203189
GO:0030027	Component	Lamellipodium	IDA	16651416
GO:0030139	Component	Endocytic vesicle	IDA	10900005
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0031295	Process	T cell costimulation	IDA	10900005, 17287217
GO:0033632	Process	Regulation of cell-cell adhesion mediated by integrin	IDA	11772392
GO:0035641	Process	Locomotory exploration behavior	IEA
GO:0036343	Process	Psychomotor behavior	IEA
GO:0042110	Process	T cell activation	IDA	7594462
GO:0042802	Function	Identical protein binding	IPI	22001206
GO:0042803	Function	Protein homodimerization activity	IPI	14684150, 15448155
GO:0042995	Component	Cell projection	IEA
GO:0043542	Process	Endothelial cell migration	IDA	16651416
GO:0045121	Component	Membrane raft	IEA
GO:0045499	Function	Chemorepellent activity	IDA	23677473
GO:0045499	Function	Chemorepellent activity	IMP	23677473
GO:0046581	Component	Intercellular canaliculus	IEA
GO:0046718	Process	Symbiont entry into host cell	NAS	23831647, 32203189
GO:0046813	Process	Receptor-mediated virion attachment to host cell	NAS	23831647, 32203189
GO:0050919	Process	Negative chemotaxis	IEA
GO:0061025	Process	Membrane fusion	NAS	23831647, 32203189
GO:0070062	Component	Extracellular exosome	HDA	11487543, 19056867, 19199708, 20458337, 21362503, 23533145
GO:0070161	Component	Anchoring junction	IEA
GO:0090024	Process	Negative regulation of neutrophil chemotaxis	IMP	23677473
GO:0120116	Process	Glucagon processing	TAS

Other IDs

• MIM: 102720
• HGNC: 3009
• e!Ensembl: ENSG00000197635

Protein

• UniProt ID: P27487
• Protein name: Dipeptidyl peptidase 4 (EC 3.4.14.5) (ADABP) (Adenosine deaminase complexing protein 2) (ADCP-2) (Dipeptidyl peptidase IV) (DPP IV) (T-cell activation antigen CD26) (TP103) (CD antigen CD26) [Cleaved into: Dipeptidyl peptidase 4 membrane form (Dipeptidyl
• Protein function: Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation (PubMed:10900005, PubMed:10951221, PubMed:11772392, PubMed:17287217). Acts as a positive regulator of T-cell c
• PDB: 1J2E, 1N1M, 1NU6, 1NU8, 1PFQ, 1R9M, 1R9N, 1RWQ, 1TK3, 1TKR, 1U8E, 1W1I, 1WCY, 1X70, 2AJL, 2BGN, 2BGR, 2BUB, 2FJP, 2G5P, 2G5T, 2G63, 2HHA, 2I03, 2I78, 2IIT, 2IIV, 2JID, 2OAG, 2OGZ, 2OLE, 2ONC, 2OPH, 2OQI, 2OQV, 2P8S, 2QJR, 2QKY, 2QOE, 2QT9, 2QTB, 2RGU, 2RIP, 3BJM, 3C43, 3C45, 3CCB, 3CCC, 3D4L, 3EIO, 3F8S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00930	DPPIV_N	108 → 479	Dipeptidyl peptidase IV (DPP IV) N-terminal region	Family
  PF00326	Peptidase_S9	559 → 765	Prolyl oligopeptidase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed specifically in lymphatic vessels but not in blood vessels in the skin, small intestine, esophagus, ovary, breast and prostate glands. Not detected in lymphatic vessels in the lung, kidney, uterus, liver and stomach (at prote
• Sequence:

  MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSL
  RWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNY
  VKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNL
  PSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSF
  YSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYL
  CDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS
  EPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISN
  EYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLY
  TLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKY
  PLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGT
  FEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWE
  YYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQIS
  KALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP

• Sequence length: 766

Pathways

KEGG:

Virion - Hepatitis viruses
Protein digestion and absorption

Reactome:

Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary angioedema with normal C1Inh	not provided	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIDDLE EAST RESPIRATORY SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERICARDITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTEINURIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	23654079		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	30332686		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	28847797, 29301579, 31115964		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	19469710		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	19469710, 29772458		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	27630212, 29310393, 29335646, 29618573, 29850606, 30310100, 31436848, 31750601, 31827684		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12634639, 12675245		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	21284881		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30698677		★☆☆☆☆ Found in Text Mining only
Adenosine deaminase deficiency	Adenosine Deaminase Deficiency	BEFREE	11067872, 6933468		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29772458		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	23469960		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	15540901, 8642848		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	15540901		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	31013793		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32803865	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	BEFREE	31237881		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	12112826		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	14679016		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	28600546		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	30195058		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	31399060	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	31971988	Associate	★☆☆☆☆ Found in Text Mining only
Angioedema	Angioedema	Pubtator	18025295	Associate	★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	29697017		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	10564557	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	10849747		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	12675253		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	31971988	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	25876091, 27887857, 29321388		★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	28179397		★☆☆☆☆ Found in Text Mining only
Aortic valve disorder	Aortic Valve Disease	BEFREE	28179397		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21558879, 23122333, 23337530, 23608773, 24363097, 26146634, 26187356, 27771154, 28081947, 28244635, 28408925, 28549747, 28619058, 28933039, 29017497, 29113797, 29220092, 29803341, 30738832		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	15681827		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	8674237		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26177310	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26353808	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	LHGDN	16700520		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31089745		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26975422, 29297467	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	27561663, 29297467, 30342583, 30977110, 31101830, 31315668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	31101830	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	32166899	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21558879, 23122333, 23337530, 23608773, 24363097, 26146634, 26187356, 27771154, 28081947, 28244635, 28408925, 28549747, 28619058, 28933039, 29017497, 29113797, 29220092, 29803341, 30586723, 30738832, 31536660		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	27771154	Inhibit	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	33030314, 40249657	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	11444929, 28507060, 28771923, 29258504, 29721673, 30762094		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	28358038, 34947986	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	25625371, 30621149		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	14611720	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	25625371, 30621149		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10849742, 24412911, 28065853, 28448874, 28462209, 28620698, 29175506, 29855994, 30691220, 30964554, 31109402, 31357088		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	12414758, 12423308, 26353808, 34220840	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	16778789, 35903860	Inhibit	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	15753397		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	20534982		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	21829465		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	21829465	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29851174		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	26715484		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	26715484, 27228385, 28125089, 31399060, 34752669, 37601204, 37876062	Associate	★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	26715484		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	34947986	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28661561, 31087620		★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	24821427	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22736146, 26267432, 29045658, 29573125, 30584072, 31140748		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14633992, 22791584, 29498809, 31991851	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31140748	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	25786689		★☆☆☆☆ Found in Text Mining only
Brooke-Spiegler syndrome	Brooke-Spiegler Syndrome	BEFREE	31576468		★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	10849747		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	10849747		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	LHGDN	12675253		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	28520234, 29274348, 29411416, 29446164, 29682739, 29706950, 29803903, 29881377, 29920976, 30090931, 30543900, 30624566, 30848289, 30989811, 31182489, 31191560, 31215644, 31275298, 31297116, 31519110, 31535624, 31570343, 31605541, 31774618		★☆☆☆☆ Found in Text Mining only
C-cell hyperplasia of thyroid	Thyroid Hyperplasia	BEFREE	28454451		★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	28169131		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16611738, 28545226, 38505912	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15027119, 8732452		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19861515, 38022651	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28661561, 31087620		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15027119, 30134935, 30698677, 31124302		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23019229, 34370716, 36799191, 37563650, 7743667, 9486416	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	7829125	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15161003, 36799191, 9587627	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12019149, 12727850, 12767062, 16054016, 19917055, 22736146		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	22125632		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18682883, 21558879, 22963445, 23469279, 25876091, 27575011, 27630212, 27813442, 28056431, 28109295, 28116795, 28130883, 28344207, 28523719, 28549747, 28619058, 28640111, 28697993, 28771625, 28799229, 28885325, 28923269, 28963101, 28990512, 29618573, 29654814, 29669555, 29671284, 29789684, 29879463, 29895330, 29935543, 30039524, 30251174, 30360455, 31018682, 31387411, 31390221, 31442511, 31586451, 31602601		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32970391, 33787603	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	28250768, 28256102, 29803341		★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	28294379		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	12675238		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28091829		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27525674, 27561653, 27647170, 27862902, 27916514, 28195389, 28522196, 28771923, 29532519, 29654814, 29776406, 30091169, 30136405, 30527909, 30832701, 31139140, 31467044, 31695754, 31808042		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	28697774, 29213240		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	29772458		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30518618		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	30507970	Associate	★☆☆☆☆ Found in Text Mining only
Chondroblastoma	Chondroblastoma	Pubtator	19817894	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	30846549	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	28318663		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	23608353, 28697774, 30246878, 30343892		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	22125632, 23461781, 27645706, 28038565, 28118775, 28122713, 28178698, 28266136, 28686724, 29231750, 29611727, 30343892, 30418475, 30553193, 30593182, 30774748, 30823876, 30841422, 30979564, 30992195, 31010001, 31112536, 31812252		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10645005, 20534982		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26992252, 28848433, 29020176		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	31584671		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	10807516		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	30714299	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	22504421	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	32803865, 33447019	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30179653, 30700100		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1347043, 21284881, 26552750		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15215186, 21284881, 9587627	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16611738		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20569697, 23175153, 24870408, 26552750, 28545226, 28813679, 29283894, 31124302		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	1347043, 15215186, 16611738, 21284881, 24142639, 24870408, 25790122, 26258407, 28545226, 31124302, 32051696, 33615655, 38203779	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	23654079		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	23654079	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Hyperinsulinemic hypoglycemia	BEFREE	26339388		★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	26339388	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27195949, 27647170, 27653447, 27819769, 27873238, 27922176, 28183314, 28195389, 28291655, 28318663, 28417296, 28432754, 28592726, 28622738, 28697774, 28733630, 28756774, 28859968, 28888840, 28899989, 28986727, 29032139, 29241903, 29249634, 29270818, 29359260, 29364549, 29364584, 29368701, 29436388, 29520964, 29525332, 29532519, 29549573, 29682682, 29735591, 29935543, 29949014, 30016946, 30039524, 30091169, 30196071, 30246878, 30318179, 30332619, 30369565, 30487758, 30586723, 30598343, 30607467, 30767126, 30767253, 30794833, 30876392, 30880253, 31018682, 31028667, 31127397, 31150300, 31175007, 31442511, 31462224, 31467044, 31479706, 31495989, 31536660, 31741435, 31816162		★☆☆☆☆ Found in Text Mining only
Contracture	Contracture	Pubtator	30972420	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	7743667		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28771625, 28847797, 30302966, 30328028, 31695754, 31773182		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23122333, 29760346, 29773079, 30302966, 30328028, 31695754		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	33030314, 33787603	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30302966, 30328028, 31695754		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	39413436	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	33787603	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	31584671		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22561447, 29693275, 30700100		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33704099	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	27091730		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30654307, 31217853, 31364869		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	31822955		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	22504421, 29138876, 30597861, 31279960, 31437816		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	22504421	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	21630437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	21630437, 25635612		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic	Atopic dermatitis	Pubtator	8615050	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	22991566	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	23792457, 25281794, 30342583		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	33655912, 34796850	Associate	★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	19817894	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11978643, 16186403, 18931022, 20082866, 21495117, 21558879, 21656024, 22552531, 23674605, 23736544, 24881464, 25140306, 27752788, 27976813, 28122713, 28150034, 28160554, 28213130, 28351157, 28376584, 28448874, 28498352, 28520234, 28556182, 28595617, 28640111, 28733630, 28771625, 28881791, 28915418, 28950045, 29027968, 29091882, 29188065, 29223646, 29258504, 29269731, 29274572, 29331088, 29411416, 29412816, 29473857, 29493228, 29493459, 29654814, 29669555, 29692250, 29739605, 29803341, 29803903, 29882783, 30026741, 30028901, 30071203, 30090931, 30136384, 30287671, 30302966, 30343892, 30452888, 30540837, 30603867, 30624566, 30638989, 30639312, 30668318, 30710452, 30767126, 30775811, 30799431, 30822272, 30894647, 30989811, 31013793, 31112536, 31124302, 31134855, 31145536, 31203700, 31215644, 31260047, 31264097, 31350829, 31366085, 31425698, 31431395, 31496802, 31529777, 31536660, 31570343, 31612835, 31697992, 31737185, 31797759, 31808042, 31822955, 31837333		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	35806251	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33188009	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11978643, 16186403, 18931022, 20082866, 21495117, 21558879, 21656024, 22552531, 23674605, 23736544, 24881464, 25140306, 26146634, 27752788, 27976813, 28122713, 28150034, 28160554, 28213130, 28344207, 28351157, 28376584, 28440488, 28448874, 28498352, 28520234, 28556182, 28592726, 28595617, 28630069, 28640111, 28733630, 28771625, 28881791, 28915418, 28950045, 29027968, 29086719, 29091882, 29188065, 29223646, 29258504, 29269731, 29274572, 29331088, 29411416, 29412816, 29473857, 29493228, 29493459, 29541610, 29605417, 29654814, 29669555, 29692250, 29739605, 29766510, 29803341, 29803903, 29882783, 30026741, 30028901, 30071203, 30090931, 30136384, 30188745, 30287671, 30302966, 30308704, 30343892, 30452888, 30540837, 30603867, 30609277, 30624566, 30638989, 30639312, 30668318, 30710452, 30738330, 30767126, 30775811, 30799431, 30822272, 30862104, 30880253, 30894647, 30927215, 30989811, 31013793, 31045223, 31108878, 31112536, 31115964, 31124302, 31134855, 31145536, 31203700, 31215644, 31260047, 31264097, 31275298, 31350829, 31366085, 31425698, 31431395, 31496802, 31500483, 31529777, 31536660, 31570343, 31612835, 31697992, 31737185, 31786186, 31797759, 31808042, 31822955, 31837333		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22504421, 23674605, 25217834, 29768061, 30894647, 31124302, 32970391, 33615655, 34089377, 34952193, 34996987, 35258398, 35635037, 36197412, 36351567, 37433152	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	21785903	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	11012666, 17040910, 21108831, 21137020, 22167343, 23197976, 23519473, 23674605, 23984879, 26855580, 26881257, 27111895, 27771154, 27858848, 28750074, 29107298, 31971988, 31991851, 32661206, 32803865, 33787603, 34907358, 36197412, 36547924, 37175783, 40142315	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27625045, 28376584, 28730750, 28781616, 28929327, 29169891, 29430979, 29442423, 29452961, 29507862, 29991320, 30333575, 30694794, 30707388, 30848158, 31398418, 31822381		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16186403, 16781669, 19126297, 20828536, 22172989, 22186413, 22891874, 23268343, 23469279, 23608773, 23674605, 24264040, 24444412, 24647737, 24831459, 25140306, 26146634, 27111895, 27139004, 27155214, 27182005, 27236239, 27249660, 27384445, 27530507, 27561663, 27585937, 27645706, 27652617, 27699599, 27745828, 27752788, 27762088, 27771154, 27773844, 27800649, 27819769, 27839908, 27840383, 27844335, 27858848, 27860391, 27873238, 27883260, 27884648, 27914297, 27916514, 27918207, 27925353, 27943565, 27964837, 27999883, 28026912, 28029729, 28039605, 28056431, 28058753, 28065853, 28078647, 28081947, 28093853, 28094469, 28098291, 28102710, 28109184, 28109295, 28116795, 28130883, 28145158, 28155089, 28160554, 28169131, 28176222, 28177187, 28182722, 28183314, 28197977, 28205322, 28237860, 28239939, 28244635, 28250768, 28260702, 28266136, 28275958, 28296349, 28302310, 28317144, 28322294, 28330386, 28332871, 28355570, 28356045, 28356718, 28358275, 28371205, 28374622, 28376584, 28378919, 28382499, 28385659, 28402902, 28403729, 28403877, 28418203, 28432754, 28440199, 28448177, 28448688, 28449320, 28452143, 28455750, 28489279, 28490565, 28507818, 28523719, 28547998, 28548024, 28550195, 28566414, 28589493, 28595617, 28596237, 28596247, 28599244, 28613952, 28626771, 28631242, 28635324, 28635331, 28640111, 28640433, 28647512, 28656707, 28659588, 28665228, 28692886, 28704854, 28713268, 28715446, 28725273, 28750074, 28756774, 28771923, 28786530, 28801475, 28801559, 28811622, 28822777, 28823610, 28827024, 28829213, 28836351, 28847268, 28847797, 28869249, 28873383, 28878934, 28880474, 28884600, 28885325, 28891092, 28893244, 28899989, 28912645, 28931178, 28938433, 28943949, 28948519, 28950392, 28950431, 28983844, 28984487, 29017497, 29036231, 29047219, 29047372, 29054111, 29056038, 29061303, 29066384, 29073562, 29074120, 29076039, 29079379, 29086531, 29093273, 29093280, 29095568, 29098166, 29107298, 29110647, 29138226, 29144805, 29145151, 29146035, 29148282, 29171139, 29172255, 29176726, 29187821, 29188065, 29199201, 29205013, 29206336, 29206832, 29213240, 29227575, 29231750, 29241903, 29246708, 29258504, 29274572, 29289540, 29301579, 29310647, 29316197, 29316236, 29317794, 29330812, 29339110, 29364549, 29364584, 29364585, 29364587, 29370218, 29376760, 29382749, 29391064, 29402270, 29405540, 29409957, 29411931, 29412814, 29412815, 29412816, 29437648, 29449146, 29468916, 29471869, 29473857, 29477373, 29491123, 29495245, 29508169, 29511288, 29525332, 29530797, 29531541, 29535389, 29536608, 29544483, 29549573, 29563098, 29572131, 29573110, 29596951, 29609120, 29611727, 29637459, 29645341, 29652078, 29654643, 29654814, 29655980, 29660786, 29667232, 29671284, 29677303, 29679391, 29713649, 29744822, 29749760, 29760346, 29766544, 29766812, 29770541, 29773079, 29773502, 29776406, 29803171, 29803910, 29848776, 29850606, 29851442, 29858660, 29858976, 29878387, 29879463, 29881377, 29895330, 29912623, 29917205, 29936573, 29941715, 29949014, 29949432, 29952007, 29974673, 29975575, 30016946, 30019498, 30022232, 30022375, 30028343, 30047217, 30049504, 30054920, 30069457, 30094725, 30103438, 30117055, 30121725, 30142816, 30145651, 30156451, 30171747, 30171949, 30172711, 30196071, 30207040, 30242112, 30242726, 30243806, 30248550, 30249630, 30255388, 30261527, 30284688, 30289315, 30294953, 30302966, 30318179, 30359860, 30360455, 30362280, 30393950, 30394576, 30417596, 30431561, 30483953, 30500110, 30506494, 30518618, 30519858, 30527909, 30536884, 30557836, 30557974, 30584072, 30586723, 30589625, 30591375, 30593182, 30597861, 30599943, 30603867, 30609212, 30611254, 30627161, 30630371, 30632692, 30642693, 30646613, 30648566, 30660990, 30694668, 30696428, 30700100, 30710655, 30714645, 30718142, 30732592, 30742667, 30759121, 30773997, 30797555, 30810254, 30821796, 30828317, 30832701, 30850916, 30857540, 30858802, 30876392, 30877707, 30894647, 30897780, 30901912, 30927215, 30941884, 30942641, 30964554, 30982160, 30992195, 31018682, 31026379, 31028667, 31045223, 31050099, 31079357, 31082700, 31094010, 31105821, 31112536, 31120717, 31121272, 31133983, 31138377, 31139140, 31150724, 31159590, 31161662, 31164969, 31167892, 31173870, 31175007, 31182338, 31182489, 31203700, 31208420, 31214997, 31219248, 31237133, 31264097, 31275243, 31275246, 31290617, 31297116, 31300870, 31308448, 31326454, 31347093, 31354492, 31357088, 31366085, 31366262, 31385198, 31390221, 31399442, 31401210, 31402899, 31418140, 31421133, 31431395, 31431452, 31434198, 31441917, 31444259, 31454094, 31462224, 31468664, 31479706, 31485457, 31496802, 31513823, 31530624, 31535624, 31536660, 31550243, 31562608, 31576595, 31585740, 31602601, 31627406, 31640215, 31642583, 31648646, 31653886, 31654243, 31656058, 31658289, 31669625, 31677134, 31683103, 31689132, 31693275, 31695754, 31706956, 31727181, 31775302, 31778076, 31788342, 31789451, 31794591, 31812252, 31823167		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	30022375		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	28393419, 31686818		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28447181		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	BEFREE	30349614		★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	29569427		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	24225429	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	22963445, 24710699, 27475229, 27625045, 28295491, 28329747, 28420715, 28881791, 29223646, 29491123, 29508169, 29913457, 29979777, 30136384, 30343892, 30425192, 30699409, 30848158, 30877711, 30940309, 31101909, 31401210, 31495989, 31701692		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29752167, 30877707, 31658289		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	8732452		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19247978		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	18931022, 27585937, 28697774, 28931178, 29199201		★☆☆☆☆ Found in Text Mining only
Dyspepsia	Dysphasia	Pubtator	40142315	Associate	★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	29713649		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	10849747		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	23792457, 25281794, 30342583		★☆☆☆☆ Found in Text Mining only
ENCEPHALITIS/ENCEPHALOPATHY, MILD, WITH REVERSIBLE MYELIN VACUOLIZATION	Encephalitis/Encephalopathy With Reversible Myelin Vacuolization	BEFREE	28348219, 28894474		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28060721		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	24825423		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	24825423	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29885296		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29509281		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29509281		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36799191	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35899307	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	25387699		★☆☆☆☆ Found in Text Mining only
Exfoliative dermatitis	Exfoliative Dermatitis	BEFREE	15781677		★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	23486063		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	20495958		★☆☆☆☆ Found in Text Mining only
Factor 8 deficiency, acquired	Factor VIII deficiency	BEFREE	30927215		★☆☆☆☆ Found in Text Mining only
Familial Partial Lipodystrophy, Type 2	Partial Lipodystrophy	BEFREE	28450900		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	26297911, 27999105, 28260070, 28942246, 29031724, 30605011, 31794591		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	40249657	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	18007554	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	22179204, 28213130, 29959534, 30359860, 31177586, 31388096		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	27815838, 30086287		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27899813, 28029729, 30797555, 31177586, 31561561		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	12112826, 22086610		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	14679016, 21412686, 22086610		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	21829465	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	29270177, 30894647		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	30894647	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	38505912	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	BEFREE	18757323		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	29242380		★☆☆☆☆ Found in Text Mining only
Gitelman Syndrome	Gitelman syndrome	Pubtator	34348722	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28452380	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31388723		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31388723		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16700508		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17786309, 22306301		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17949241	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	12423308, 34334382	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	10951408		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	36056316	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	29175506, 31670093		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	37675735, 38127960	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22674411	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27195949, 27647170, 27653447, 27819769, 27873238, 27922176, 28183314, 28195389, 28291655, 28417296, 28432754, 28592726, 28622738, 28697774, 28733630, 28756774, 28859968, 28888840, 28899989, 28986727, 29032139, 29241903, 29249634, 29270818, 29359260, 29364549, 29364584, 29368701, 29436388, 29520964, 29525332, 29532519, 29549573, 29682682, 29735591, 29935543, 29949014, 30016946, 30039524, 30091169, 30196071, 30246878, 30318179, 30332619, 30369565, 30487758, 30586723, 30598343, 30607467, 30767126, 30767253, 30794833, 30876392, 30880253, 31018682, 31028667, 31127397, 31150300, 31175007, 31442511, 31462224, 31467044, 31479706, 31495989, 31536660, 31741435, 31816162		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30369565, 32113627	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30369565	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	39337249	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11448921, 23469960, 30574454		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	30714299		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	24778155		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	9548412		★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	9548412		★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	26339796, 28376103	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	17071493		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18362907, 35111387	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	23469960, 8541553		★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops fetalis	Pubtator	34511175	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	29754453, 30406296		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	18931022, 20455069, 21558879, 25140306, 27530507, 28118069, 28351157, 28374622, 28393419, 28659588, 28725273, 28869249, 29138226, 29199201, 29223646, 29364549, 29364584, 29412816, 29507662, 29776406, 29777520, 30591375, 30611254, 30828317, 30972338, 31126115, 31139140, 31353426, 31398418, 31402899, 31496870, 31808042		★☆☆☆☆ Found in Text Mining only
Hyperinsulinemic hypoglycemia	Hyperinsulinemic hypoglycemia	BEFREE	26339388		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	24947356, 29241374, 30446906		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	11882590		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24328731, 28122713, 28556182, 28697774, 29402981, 29789684, 30354710, 30406296, 30599943, 30630371, 30634956, 30774748, 31095977		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	16629719, 27155214, 27762088, 27800649, 28093996, 28178698, 28238223, 28275958, 28351157, 28397367, 28498352, 28544214, 28704854, 28950431, 29047219, 29047372, 29223646, 29364584, 29436388, 29493100, 29645341, 29713649, 29878387, 29895330, 29917205, 30117055, 30155646, 30242726, 30284688, 30431561, 30457671, 30603867, 30611254, 30694668, 30710655, 30775811, 30901912, 31020720, 31275243, 31279738, 31354492, 31567175, 31666589, 31706956, 31787718		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29175506		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24825423	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25217834, 26881257	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33143089	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	17346218, 18456553, 28448874, 29772527, 31194830		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10698152, 10933954, 11067872, 15753397		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22504421, 28056430, 29334906, 29793329, 31062332, 31126115, 31399442		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	12675254		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19253308, 33704099, 35060938	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22561447, 29270177, 29563098, 30700100, 30964554, 31359088, 31471377		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24130353, 35806251	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	25119061, 28376584, 29169891		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	31822955		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	30186247		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	31992267, 37868053	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	28630262		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	27647170, 31115964, 31773182		★☆☆☆☆ Found in Text Mining only
Jaundice, Chronic Idiopathic	Jaundice	BEFREE	8621134		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	18189200		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	28736981		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	16061680		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	LHGDN	17071493		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	18931022, 27475229, 27820706, 28326327, 29320602, 29364584, 29491123, 29691065, 30553193, 30586723, 30607467, 30648566, 30774748, 31018682, 31138377, 31401210, 31695754		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34697593, 36799191	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	28983844, 30019498		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	28651949	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28881791, 30310100, 30343892, 30624740		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	23608353, 28697774, 30246878, 30343892		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	20459800	Associate	★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	28929327, 29452961, 29883070, 31148332		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29249634		★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	28733630, 29032139		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19469710, 22398368, 27145281, 30714299, 37457737	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23469960		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19469710, 30846549, 37457737	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36424441	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	15540901		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	8959560		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29409972, 29524519		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	10807516		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	26339796	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28348219		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	34944016, 37896834	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25638566, 31124302, 35650221, 38060494	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	12414758	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30964554		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	8541553		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	23469960		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	12675243		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	28083948		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	31750601		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	19247978		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	17634548, 22369943, 24466195, 30197002		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21281985, 26267432, 29045658, 29573125, 30584072, 31140748		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29509281		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29409972		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30134935, 30698677, 31124302		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	8959560		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12019149, 12727850, 12767062, 16054016		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29335646, 31431452, 31750601, 31769894, 31774618		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15016824, 15735018, 30242112		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26471376		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28575350, 30229901		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28661561, 31087620		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11467771, 12019149, 15086915, 15540901, 16054016, 16061680, 17346218, 17634548, 19917055, 20074209, 21281985, 21894438, 22086610, 22369943, 22736146, 23638030, 24180670, 24318733, 24466195, 24778155, 25056937, 26267432, 26370256, 28060721, 28448874, 28462209, 28545226, 28575350, 28620698, 28811622, 28943949, 29176726, 29409972, 29493228, 29573125, 29692250, 29772527, 29882783, 30229901, 30242112, 30302966, 30511572, 30584072, 30822465, 31124302, 31194830, 31285270, 31303072, 31496802, 31750601, 8642848, 8959560		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	1347043, 21284881, 26552750		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21281985		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	19247978		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28454451		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10430620, 11467771, 17981724		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10430620, 16829852	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22398368, 22908963	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	36799191	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	20043068		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	21630437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	21630437, 25635612		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	BEFREE	20338946, 21894438, 22261805, 30822465		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	32530527, 35409274	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	12529175, 24142639	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27999105, 28790917, 29205013, 29331088		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20847730, 21593202, 27111895, 29107298	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18682883, 20847730, 21593202, 24130353, 27918207, 29107298, 29205013, 29520469, 29958403, 30889182		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	15735018, 25056937		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29572131, 30886577, 31204117		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	31829262		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	31829262	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	15161003	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23469960, 28620928, 30348967		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37666354	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10849742, 22653658, 23226199, 24412911, 28448874, 28778440, 30964554, 31829262		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31829262	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29326589		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	10593570	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	18727078, 31050147	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	28533196	Inhibit	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	23651669, 24778155, 29031704, 29900128, 30574454, 30714299, 31303072		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	12414758	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	22167343	Inhibit	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	23122333, 27647170, 27862902, 28195389, 28542373, 28587613, 28847797, 28966327, 29150631, 29253907, 29532519, 30087386, 30091169, 30456843, 30527909, 30589625, 30638989, 30823876, 30832701, 31467044		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28771625, 28847797, 29435776, 31773182		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	31203438		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	2168821, 34796850	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	27990763		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	40142315	Inhibit	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	34796850	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10645005, 11448921, 15027119, 15735018, 15753397, 16061680, 17346218, 17634548, 17786309, 17981724, 18672285, 19247978, 19917055, 20459800, 20569697, 20872224, 21765471, 21894438, 22306301, 23638030, 23686701, 24870408, 25119061, 26267432, 26370256, 26471376, 26552750, 28545226, 28575350, 29481642, 29524519, 30242112, 30584072, 30714299, 30778250, 30822465, 31124302, 31140748, 31194830, 31398954, 8541553		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29451201		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29864483, 30688255, 31714795, 31728850		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	25119061		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	22179204, 24264040, 26297911, 28077733, 28260070, 28637594, 29031724, 29188065, 29201174, 30810254, 31672448		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15027119, 30134935		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27999105, 29201174, 29203247		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18682883, 21593202, 23408696, 24130353, 24831459, 26001373, 27561663, 28122713, 28222464, 28356045, 28987239, 29144805, 29154902, 29409972, 29562231, 29606326, 29797022, 29850829, 30116740, 30359860, 30410858, 30738832, 30828317, 30896318, 31387411, 31402899		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20847730, 21593202, 24130353, 26881257, 40142315	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36428961	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	24130353	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	20847730		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28713268, 31541189		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23686701		★☆☆☆☆ Found in Text Mining only
Otospondylomegaepiphyseal dysplasia	Otospondylomegaepiphyseal Dysplasia	BEFREE	28432754		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	12019149, 12727850, 12767062, 16054016		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33143089	Associate	★☆☆☆☆ Found in Text Mining only
Pain Insensitivity Congenital	Congenital pain insensitivity	Pubtator	34947986	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29335646, 31431452, 31750601, 31769894, 31774618		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29556215		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36061308, 36799191	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	29556215, 29850606, 30557974, 30607467, 30674350, 31018682, 31774618		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	14679016, 28575350, 30594915, 31213841		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27503084, 29766510		★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	10951408		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	30848289, 36685490	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	34089377, 35958564	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	21468772, 27884648		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	27884648, 28697774		★☆☆☆☆ Found in Text Mining only
Platelet Glycoprotein IV Deficiency	Platelet Glycoprotein IV Deficiency	BEFREE	30738832		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28228317, 28799235, 29064743, 29144805, 30394149, 30515927, 30896318, 31260047, 31529097		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35477803	Inhibit	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	19469710		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	29195509		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	22504421, 29138876, 30597861, 31279960, 31437816		★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	25313508	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15016824, 15735018, 30242112		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	29851174		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11284727, 20021671, 24768141, 28055971, 37533175, 40022828	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12675248, 18563594		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34556748	Inhibit	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	26339796		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	26767505, 34089377	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28365081, 30518187		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29020176	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29037205, 31350829		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	26370256		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	7743667		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	27820706, 28118775, 29607314, 30877711, 31401210		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	18931022, 27180612, 27761990, 28449320, 28879786, 29246708, 29611727, 29667921, 29917205, 29974673, 30019498, 30054920, 30777033, 31385198, 31454094, 31669883		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30188745		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29752167, 30012674, 30097694		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	24782177		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	24782177		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26177310, 27341562, 27587881, 27990763, 28599787, 29236221, 30028343, 30136129, 30964554		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	31794148	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	7911242		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	34947986	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	8484693	Associate	★☆☆☆☆ Found in Text Mining only
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	BEFREE	31576468		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	34947986	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	40613196	Associate	★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	11067872, 6933468		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	LHGDN	17610364		★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency disease	BEFREE	11067872, 6933468		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	16088151, 18089499, 18672285, 22417305, 23792457, 31050147, 31487384		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	16204308, 31050147	Inhibit	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	18727078, 20663947, 23792457, 25511143, 26930587	Associate	★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	29987877		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34220840	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	26930587	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	30136129		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	21765471		★☆☆☆☆ Found in Text Mining only
Spermatic Cord Torsion	Spermatic Cord Torsion	BEFREE	31773182		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	30463640		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	30188931		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31140748		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22252752, 22252753, 31992267, 37116157	Associate	★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	28587613, 28733630		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26297911, 27999105, 28029729, 28260070, 28637594, 28942246, 29031724, 29203247, 29959534, 30605011, 31794591		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26471376		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26471376, 36799191, 37752199, 37868053, 38505912	Associate	★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	31260047		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	31500483		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	27990763, 31350829		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10887640, 11448921, 8541553		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	31126115		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	34906163	Associate	★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	27228385	Associate	★☆☆☆☆ Found in Text Mining only
Thanatophoric dysplasia, type 2	Thanatophoric Dysplasia	BEFREE	30591375		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	22167343	Inhibit	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	28625631		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	11752453, 17914110, 32879160	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	37675735	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12112826, 14679016, 27776138, 28575350, 30229901, 8732452		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	12112826, 22086610		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28575350, 30229901		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27776138, 28982310, 32970391, 36281116, 36407322, 36799191	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	12112826		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	LHGDN	12112826		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	35903860	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30700100		★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	27936466		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26222679	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	28697993		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	28916770	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	28376103		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	28376103	Inhibit	★☆☆☆☆ Found in Text Mining only