DXO (decapping exoribonuclease)

Gene

• Entrez ID: 1797
• Gene name: Decapping exoribonuclease
• Gene symbol: DXO
• Synonyms (NCBI Gene): DOM3L, DOM3Z, NG6, RAI1
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. The function of its protein product is unknown, but its ubiquitous expression and conservation in both simple and complex eukaryotes suggests that this may

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	ISS
GO:0000956	Process	Nuclear-transcribed mRNA catabolic process	IBA
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	ISS
GO:0004518	Function	Nuclease activity	IEA
GO:0004527	Function	Exonuclease activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	29601584
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006402	Process	MRNA catabolic process	IDA	29601584
GO:0006402	Process	MRNA catabolic process	ISS
GO:0008409	Function	5'-3' exonuclease activity	ISS
GO:0016787	Function	Hydrolase activity	IEA
GO:0034353	Function	MRNA 5'-diphosphatase activity	IBA
GO:0034353	Function	MRNA 5'-diphosphatase activity	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050779	Process	RNA destabilization	ISS
GO:0071028	Process	Nuclear mRNA surveillance	ISS
GO:0090304	Process	Nucleic acid metabolic process	ISS
GO:0110152	Function	RNA NAD+-cap (NAD+-forming) hydrolase activity	IEA
GO:0110152	Function	RNA NAD+-cap (NAD+-forming) hydrolase activity	ISS
GO:0110155	Process	NAD-cap decapping	IBA
GO:0110155	Process	NAD-cap decapping	IDA	28283058, 31101919

Other IDs

• MIM: 605996
• HGNC: 2992
• e!Ensembl: ENSG00000204348

Protein

• UniProt ID: O77932
• Protein name: Decapping and exoribonuclease protein (DXO) (EC 3.6.1.-) (5'-3' exoribonuclease DXO) (EC 3.1.13.-) (Dom-3 homolog Z) (NAD-capped RNA hydrolase DXO) (DeNADding enzyme DXO) (EC 3.6.1.-)
• Protein function: Decapping enzyme for NAD-capped RNAs: specifically hydrolyzes the nicotinamide adenine dinucleotide (NAD) cap from a subset of RNAs by removing the entire NAD moiety from the 5'-end of an NAD-capped RNA (PubMed:28283058). The NAD-cap is present
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08652	RAI1	235 → 302	RAI1 like PD-(D/E)XK nuclease	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:9799600}.
• Sequence:

  MDPRGTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQY
  HGDARALRYYSPPPTNGPGPNFDLRDGYPDRYQPRDEEVQERLDHLLCWLLEHRGRLEGG
  PGWLAEAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPNARAQRLARPPL
  LRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLGSHPLLFSGEVDCTDP
  QAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPNVVAGFRNPDGFV
  SSLKTFPTMKMFEYVRNDRDGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGP
  VTVSVHQDAPYAFLPIWYVEAMTQDLPSPPKTPSPK

• Sequence length: 396

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CERVICAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31164795		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31164795		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35273654	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	9163605		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31698971		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11487501		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31164795		★☆☆☆☆ Found in Text Mining only
Mevalonate Kinase Deficiency	Mevalonate kinase deficiency	Pubtator	29268706	Associate	★☆☆☆☆ Found in Text Mining only