DNASE1L3 (deoxyribonuclease 1L3)

Gene

• Entrez ID: 1776
• Gene name: Deoxyribonuclease 1L3
• Gene symbol: DNASE1L3
• Synonyms (NCBI Gene): D3, DHP2, DNAS1L3, LSD, SLEB16
• Chromosome: 3
• Chromosome location: 3p14.3
• Summary: This gene encodes a member of the deoxyribonuclease I family. The encoded protein hydrolyzes DNA, is not inhibited by actin, and mediates the breakdown of DNA during apoptosis. Mutations in this gene are a cause of systemic lupus erythematosus-16. Alterna

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1575496354	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs1575497576	->T	Pathogenic	Frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016727	hsa-miR-335-5p	Microarray	18185580
MIRT609493	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT609492	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT609491	hsa-miR-6812-3p	HITS-CLIP	23824327
MIRT609490	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT609489	hsa-miR-1184	HITS-CLIP	23824327
MIRT609488	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT609487	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT609486	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609485	hsa-miR-7156-3p	HITS-CLIP	23824327
MIRT609484	hsa-miR-4725-5p	HITS-CLIP	23824327
MIRT609495	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT609494	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT609493	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT609492	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT609491	hsa-miR-6812-3p	HITS-CLIP	23824327
MIRT609490	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT609489	hsa-miR-1184	HITS-CLIP	23824327
MIRT609488	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT609487	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT609486	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609485	hsa-miR-7156-3p	HITS-CLIP	23824327
MIRT609484	hsa-miR-4725-5p	HITS-CLIP	23824327
MIRT609493	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT609492	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT609491	hsa-miR-6812-3p	HITS-CLIP	23824327
MIRT609490	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT609489	hsa-miR-1184	HITS-CLIP	23824327
MIRT609488	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT609487	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT609486	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609485	hsa-miR-7156-3p	HITS-CLIP	23824327
MIRT609484	hsa-miR-4725-5p	HITS-CLIP	23824327
MIRT609495	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT609494	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT609493	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT609492	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT609491	hsa-miR-6812-3p	HITS-CLIP	23824327
MIRT609490	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT609489	hsa-miR-1184	HITS-CLIP	23824327
MIRT609488	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT609487	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT609486	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609485	hsa-miR-7156-3p	HITS-CLIP	23824327
MIRT609484	hsa-miR-4725-5p	HITS-CLIP	23824327
MIRT942182	hsa-miR-1303	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002283	Process	Neutrophil activation involved in immune response	IEA
GO:0002283	Process	Neutrophil activation involved in immune response	ISS	29191910
GO:0002673	Process	Regulation of acute inflammatory response	IEA
GO:0002673	Process	Regulation of acute inflammatory response	ISS	29191910
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	9070308
GO:0003824	Function	Catalytic activity	IEA
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004520	Function	DNA endonuclease activity	IEA
GO:0004530	Function	Deoxyribonuclease I activity	IBA
GO:0004536	Function	DNA nuclease activity	IEA
GO:0004536	Function	DNA nuclease activity	TAS	9070308
GO:0005509	Function	Calcium ion binding	TAS	9205125
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	23229555
GO:0005634	Component	Nucleus	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	23229555
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0006259	Process	DNA metabolic process	TAS	9070308
GO:0006308	Process	DNA catabolic process	IEA
GO:0006309	Process	Apoptotic DNA fragmentation	IBA
GO:0006309	Process	Apoptotic DNA fragmentation	IDA	23229555
GO:0006309	Process	Apoptotic DNA fragmentation	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0010623	Process	Programmed cell death involved in cell development	IBA
GO:0010623	Process	Programmed cell death involved in cell development	IEA
GO:0012501	Process	Programmed cell death	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0070948	Process	Regulation of neutrophil mediated cytotoxicity	IEA
GO:0070948	Process	Regulation of neutrophil mediated cytotoxicity	ISS	29191910

Other IDs

• MIM: 602244
• HGNC: 2959
• e!Ensembl: ENSG00000163687

Protein

• UniProt ID: Q13609
• Protein name: Deoxyribonuclease gamma (DNase gamma) (EC 3.1.21.-) (DNase I homolog protein DHP2) (Deoxyribonuclease I-like 3) (DNase I-like 3) (Liver and spleen DNase) (LS-DNase) (LSD)
• Protein function: Has DNA hydrolytic activity. Is capable of both single- and double-stranded DNA cleavage, producing DNA fragments with 3'-OH ends (By similarity). Can cleave chromatin to nucleosomal units and cleaves nucleosomal and liposome-coated DNA (PubMed:
• PDB: 7KIU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03372	Exo_endo_phos	24 → 274	Endonuclease/Exonuclease/phosphatase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Liver and spleen.
• Sequence:

  MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEI
  KDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYH
  DYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWK
  AENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRG
  QEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKT
  KSKRS

• Sequence length: 305

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autosomal systemic lupus erythematosus type 16	Likely pathogenic; Pathogenic	rs751206379, rs2107373870, rs1164270727, rs2471306385, rs1575496354, rs1575497576	RCV001526441 RCV001824250 RCV005034492 RCV004584153 RCV000023182 RCV005036138	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
DNASE1L3-related disorder	Likely pathogenic; Pathogenic	rs751206379	RCV003416385	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL SYSTEMIC LUPUS ERYTHEMATOSUS	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIMITED SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS 16	—	Disgenet, HPO Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult type dermatomyositis	Dermatomyositis	BEFREE	28039554		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	31794766		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29560311, 30005328, 30821651		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29560311, 30005328, 30821651		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33173951	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24582314, 30682452		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31903716	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33035569	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	17406648		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27116004, 27821515, 28039554, 30593563, 31794766		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	33173951, 36708011	Associate	★☆☆☆☆ Found in Text Mining only
Autosomal systemic lupus erythematosus	Systemic lupus erythematosus	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	33971891	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31977318, 33744849, 33879119, 34726341, 35035517, 39223584	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35748106	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	40065365	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28349958	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34157681, 37950156	Inhibit	★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Conjunctivitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28349958		★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29560311, 30628811		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	28039554		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35257412	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37867508	Associate	★☆☆☆☆ Found in Text Mining only
Episcleritis	Episcleritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	23434032	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31210983		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	28940312		★☆☆☆☆ Found in Text Mining only
Hemiplegia/hemiparesis	Hemiplegia/hemiparesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	38081297	Associate	★☆☆☆☆ Found in Text Mining only
Hypocomplementemic urticarial vasculitis	Hypocomplementemic Urticarial Vasculitis	ORPHANET_DG	23666765		★☆☆☆☆ Found in Text Mining only
Hypocomplementemic urticarial vasculitis	Hypocomplementemic Urticarial Vasculitis	Orphanet			★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	22019780		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	28039554		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	21720004		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	21720004	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23666765, 25332064, 30707351, 33173951, 33455918, 35964089, 36941260, 37048133	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32188756	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22019780, 23666765, 27293190, 27821515, 28039554, 28533778, 31092713		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	22019780		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	30573655		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	22019780, 31092713		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	30892133		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	16427601		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	21720004		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31341245		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31490510		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29560311, 30628811		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28831571		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	24411530, 30102082		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	28443617, 31136924		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	GWASCAT_DG	30573655		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	4994465		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	21550210, 24411530, 29560311, 30836890, 6870484		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	BEFREE	25741867		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	24411530		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31399862		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	12154052		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	12154052		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	28039554		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31020892		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30518632		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	21550210, 24411530, 29560311, 30836890, 6870484		★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	24582314		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	28039554		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	23143596, 30224649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	23143596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	23143596, 30573655		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28039554		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	23176747, 28243163, 6870484, 9387886		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	25332064		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	25332064, 33173951, 36708011	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma, Limited	Scleroderma	GWASCAT_DG	24387989		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	34529670	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	19574717	Stimulate	★☆☆☆☆ Found in Text Mining only
Small vessel vasculitis	Small vessel vasculitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
SYSTEMIC LUPUS ERYTHEMATOSUS 16	Systemic lupus erythematosus	GENOMICS_ENGLAND_DG	22019780		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS 16	Systemic lupus erythematosus	ORPHANET_DG	22019780		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	BEFREE	24387989, 25332064		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASCAT_DG	24387989, 28314753, 30573655		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	14725611	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	HPO_DG			★☆☆☆☆ Found in Text Mining only