Gene Gene information from NCBI Gene database.
Entrez ID 1746
Gene name Distal-less homeobox 2
Gene symbol DLX2
Synonyms (NCBI Gene)
TES-1TES1
Chromosome 2
Chromosome location 2q31.1
Summary Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed
miRNA miRNA information provided by mirtarbase database.
120
miRTarBase ID miRNA Experiments Reference
MIRT043264 hsa-miR-331-3p CLASH 23622248
MIRT042820 hsa-miR-324-3p CLASH 23622248
MIRT036105 hsa-miR-1296-5p CLASH 23622248
MIRT567747 hsa-miR-551b-5p PAR-CLIP 20371350
MIRT567746 hsa-miR-300 PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
51
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000976 Function Transcription cis-regulatory region binding ISS
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
126255 2915 ENSG00000115844
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q07687
Protein name Homeobox protein DLX-2
Protein function Acts as a transcriptional activator (By similarity). Activates transcription of CGA/alpha-GSU, via binding to the downstream activin regulatory element (DARE) in the gene promoter (By similarity). Plays a role in terminal differentiation of inte
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12413 DLL_N 51 132 Homeobox protein distal-less-like N terminal Family
PF00046 Homeodomain 153 209 Homeodomain Domain
Sequence
MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVST
ATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYA
PYGTSSSPANNE
PEKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALP
ERAELAASLGLTQTQVKIWFQNRRSKFKK
MWKSGEIPSEQHPGASASPPCASPPVSAPAS
WDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTSGSASHLQATAPLL
HPTQTPQPHHHHHHHGGGGAPVSAGTIF
Sequence length 328
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTISTIC DISORDER CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
AL-RAQAD SYNDROME AL-Raqad Syndrome BEFREE 11929847, 15751970
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma Pubtator 20233874 Associate
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorder Autism Pubtator 18728693 Associate
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 18728693
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism BEFREE 18728693, 19018235
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autistic Disorder Autism LHGDN 18728693
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autistic Disorder Autism CTD_human_DG 18728693
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autistic Disorder Autism Pubtator 18728693 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases Autoimmune disease Pubtator 36317140 Associate
★☆☆☆☆
Found in Text Mining only
Axenfeld-Rieger syndrome Axenfeld anomaly BEFREE 11929847
★☆☆☆☆
Found in Text Mining only