UBE2L5 (ubiquitin conjugating enzyme E2 L5)

Gene

• Entrez ID: 171222
• Gene name: Ubiquitin conjugating enzyme E2 L5
• Gene symbol: UBE2L5
• Synonyms (NCBI Gene): UBCH7N2, UBE2L5P
• Chromosome: 13
• Chromosome location: 13q12.3

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016874	Function	Ligase activity	IEA
GO:0019787	Function	Ubiquitin-like protein transferase activity	IEA
GO:0032446	Process	Protein modification by small protein conjugation	IEA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IEA
GO:0070979	Process	Protein K11-linked ubiquitination	IBA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: A0A1B0GUS4
• Protein name: Ubiquitin-conjugating enzyme E2 L5 (EC 2.3.2.23) (Ubiquitin-protein ligase L5)
• Protein function: Catalyzes the covalent attachment of ubiquitin to other proteins.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00179	UQ_con	6 → 144	Ubiquitin-conjugating enzyme	Domain

• Sequence:

  MAASRRLMKELEEIRKCGMENFRNIQVDEANLLTWQGLIVPDNPPYNKGAFRIEINFPAE
  YPFKPPRITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHP
  LRADLAEEYSNDRKKFCKNAEEFTKKYGEKRPVD

• Sequence length: 154

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations