KCNG3 (potassium voltage-gated channel modifier subfamily G member 3)

Gene

• Entrez ID: 170850
• Gene name: Potassium voltage-gated channel modifier subfamily G member 3
• Gene symbol: KCNG3
• Synonyms (NCBI Gene): KV10.1, KV6.3
• Chromosome: 2
• Chromosome location: 2p21
• Summary: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027010	hsa-miR-103a-3p	Sequencing	20371350
MIRT027271	hsa-miR-101-3p	Sequencing	20371350
MIRT031572	hsa-miR-16-5p	Sequencing	20371350
MIRT1080977	hsa-miR-1178	CLIP-seq
MIRT1080978	hsa-miR-451b	CLIP-seq
MIRT1080979	hsa-miR-1253	CLIP-seq
MIRT1080980	hsa-miR-2054	CLIP-seq
MIRT1080981	hsa-miR-3185	CLIP-seq
MIRT2020071	hsa-miR-4282	CLIP-seq
MIRT2251902	hsa-miR-3671	CLIP-seq
MIRT2251903	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001508	Process	Action potential	IBA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005249	Function	Voltage-gated potassium channel activity	IEA
GO:0005267	Function	Potassium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	11852086
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	12060745
GO:0005886	Component	Plasma membrane	IDA	12060745, 19074135
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	19074135
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	IDA	11852086, 12060745, 19074135
GO:0015459	Function	Potassium channel regulator activity	IEA
GO:0015459	Function	Potassium channel regulator activity	IGI	15046870
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0043266	Process	Regulation of potassium ion transport	IDA	11852086, 12060745
GO:0043266	Process	Regulation of potassium ion transport	IEA
GO:0043266	Process	Regulation of potassium ion transport	IGI	15046870
GO:0051260	Process	Protein homooligomerization	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IDA	19074135

Other IDs

• MIM: 606767
• HGNC: 18306
• e!Ensembl: ENSG00000171126

Protein

• UniProt ID: Q8TAE7
• Protein name: Voltage-gated potassium channel regulatory subunit KCNG3 (Potassium voltage-gated channel subfamily G member 3) (Voltage-gated potassium channel subunit Kv10.1) (Voltage-gated potassium channel subunit Kv6.3)
• Protein function: Regulatory subunit of the voltage-gated potassium (Kv) channel which, when coassembled with KCNB1, modulates the kinetics parameters of the heterotetrameric channel namely the inactivation and deactivation rate (PubMed:11852086, PubMed:12060745,
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02214	BTB_2	11 → 111	BTB/POZ domain	Domain
  PF00520	Ion_trans	170 → 420	Ion transport protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the brain, liver, testis, small intestine, colon, thymus and adrenal gland (PubMed:11852086, PubMed:12060745). {ECO:0000269|PubMed:11852086, ECO:0000269|PubMed:12060745}.
• Sequence:

  MTFGRSGAASVVLNVGGARYSLSRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNE
  YFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRM
  SDTYTFYSADEPGVLGRDEARPGGAEAAPSRRWLERMRRTFEEPTSSLAAQILASVSVVF
  VIVSMVVLCASTLPDWRNAAADNRSLDDRSRYSAGPGREPSGIIEAICIGWFTAECIVRF
  IVSKNKCEFVKRPLNIIDLLAITPYYISVLMTVFTGENSQLQRAGVTLRVLRMMRIFWVI
  KLARHFIGLQTLGLTLKRCYREMVMLLVFICVAMAIFSALSQLLEHGLDLETSNKDFTSI
  PAACWWVIISMTTVGYGDMYPITVPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELK
  FRSARYSRSLSTEFLN

• Sequence length: 436

Pathways

Reactome:

Voltage gated Potassium channels

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anus, Imperforate	Imperforate anus	BEFREE	30386900		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	26530050	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	26530050	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30718673	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26530050	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	30386900		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	28380430	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28380430	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22143938		★☆☆☆☆ Found in Text Mining only