ADAMTS15 (ADAM metallopeptidase with thrombospondin type 1 motif 15)

Gene

• Entrez ID: 170689
• Gene name: ADAM metallopeptidase with thrombospondin type 1 motif 15
• Gene symbol: ADAMTS15
• Synonyms (NCBI Gene): DA12
• Chromosome: 11
• Chromosome location: 11q24.3
• Summary: This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegri

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT723925	hsa-miR-6858-3p	HITS-CLIP	19536157
MIRT723924	hsa-miR-208a-5p	HITS-CLIP	19536157
MIRT723923	hsa-miR-208b-5p	HITS-CLIP	19536157
MIRT723922	hsa-miR-6723-5p	HITS-CLIP	19536157
MIRT723921	hsa-miR-4540	HITS-CLIP	19536157
MIRT723920	hsa-miR-137	HITS-CLIP	19536157
MIRT723925	hsa-miR-6858-3p	HITS-CLIP	19536157
MIRT723924	hsa-miR-208a-5p	HITS-CLIP	19536157
MIRT723923	hsa-miR-208b-5p	HITS-CLIP	19536157
MIRT723922	hsa-miR-6723-5p	HITS-CLIP	19536157
MIRT723921	hsa-miR-4540	HITS-CLIP	19536157
MIRT723920	hsa-miR-137	HITS-CLIP	19536157
MIRT766397	hsa-miR-1204	CLIP-seq
MIRT766398	hsa-miR-122	CLIP-seq
MIRT766399	hsa-miR-1243	CLIP-seq
MIRT766400	hsa-miR-1262	CLIP-seq
MIRT766401	hsa-miR-1273	CLIP-seq
MIRT766402	hsa-miR-299-3p	CLIP-seq
MIRT766403	hsa-miR-3155	CLIP-seq
MIRT766404	hsa-miR-3155b	CLIP-seq
MIRT766405	hsa-miR-3180-5p	CLIP-seq
MIRT766406	hsa-miR-3197	CLIP-seq
MIRT766407	hsa-miR-320a	CLIP-seq
MIRT766408	hsa-miR-320b	CLIP-seq
MIRT766409	hsa-miR-320c	CLIP-seq
MIRT766410	hsa-miR-320d	CLIP-seq
MIRT766411	hsa-miR-3607-3p	CLIP-seq
MIRT766412	hsa-miR-3612	CLIP-seq
MIRT766413	hsa-miR-3654	CLIP-seq
MIRT766414	hsa-miR-3686	CLIP-seq
MIRT766415	hsa-miR-3913-3p	CLIP-seq
MIRT766416	hsa-miR-4279	CLIP-seq
MIRT766417	hsa-miR-4429	CLIP-seq
MIRT766418	hsa-miR-4443	CLIP-seq
MIRT766419	hsa-miR-4470	CLIP-seq
MIRT766420	hsa-miR-4649-3p	CLIP-seq
MIRT766421	hsa-miR-4652-3p	CLIP-seq
MIRT766422	hsa-miR-4685-5p	CLIP-seq
MIRT766423	hsa-miR-4690-3p	CLIP-seq
MIRT766424	hsa-miR-4701-3p	CLIP-seq
MIRT766425	hsa-miR-4707-5p	CLIP-seq
MIRT766426	hsa-miR-4755-3p	CLIP-seq
MIRT766427	hsa-miR-4764-5p	CLIP-seq
MIRT766428	hsa-miR-484	CLIP-seq
MIRT766429	hsa-miR-489	CLIP-seq
MIRT766430	hsa-miR-505	CLIP-seq
MIRT766431	hsa-miR-650	CLIP-seq
MIRT1925792	hsa-miR-1225-3p	CLIP-seq
MIRT1925793	hsa-miR-1233	CLIP-seq
MIRT1925794	hsa-miR-1913	CLIP-seq
MIRT1925795	hsa-miR-3157-5p	CLIP-seq
MIRT1925796	hsa-miR-324-3p	CLIP-seq
MIRT1925797	hsa-miR-331-3p	CLIP-seq
MIRT766411	hsa-miR-3607-3p	CLIP-seq
MIRT766414	hsa-miR-3686	CLIP-seq
MIRT1925798	hsa-miR-3909	CLIP-seq
MIRT1925799	hsa-miR-4505	CLIP-seq
MIRT1925800	hsa-miR-455-3p	CLIP-seq
MIRT766421	hsa-miR-4652-3p	CLIP-seq
MIRT1925801	hsa-miR-4672	CLIP-seq
MIRT1925802	hsa-miR-4691-3p	CLIP-seq
MIRT1925803	hsa-miR-4701-5p	CLIP-seq
MIRT1925804	hsa-miR-4711-5p	CLIP-seq
MIRT1925805	hsa-miR-4728-5p	CLIP-seq
MIRT1925806	hsa-miR-4789-5p	CLIP-seq
MIRT766430	hsa-miR-505	CLIP-seq
MIRT1925807	hsa-miR-588	CLIP-seq
MIRT2167133	hsa-miR-1226	CLIP-seq
MIRT2167134	hsa-miR-1324	CLIP-seq
MIRT2167135	hsa-miR-1915	CLIP-seq
MIRT2167136	hsa-miR-3175	CLIP-seq
MIRT2167137	hsa-miR-3184	CLIP-seq
MIRT766411	hsa-miR-3607-3p	CLIP-seq
MIRT2167138	hsa-miR-3617	CLIP-seq
MIRT766414	hsa-miR-3686	CLIP-seq
MIRT2167139	hsa-miR-423-5p	CLIP-seq
MIRT2167140	hsa-miR-4428	CLIP-seq
MIRT2167141	hsa-miR-4463	CLIP-seq
MIRT2167142	hsa-miR-4476	CLIP-seq
MIRT2167143	hsa-miR-4533	CLIP-seq
MIRT766421	hsa-miR-4652-3p	CLIP-seq
MIRT1925801	hsa-miR-4672	CLIP-seq
MIRT766423	hsa-miR-4690-3p	CLIP-seq
MIRT2167144	hsa-miR-4716-3p	CLIP-seq
MIRT2167145	hsa-miR-4723-5p	CLIP-seq
MIRT2167146	hsa-miR-4733-3p	CLIP-seq
MIRT2167147	hsa-miR-4796-5p	CLIP-seq
MIRT766430	hsa-miR-505	CLIP-seq
MIRT2167148	hsa-miR-641	CLIP-seq
MIRT766399	hsa-miR-1243	CLIP-seq
MIRT2383898	hsa-miR-128	CLIP-seq
MIRT2383899	hsa-miR-134	CLIP-seq
MIRT2383900	hsa-miR-3118	CLIP-seq
MIRT2383901	hsa-miR-3194-5p	CLIP-seq
MIRT766412	hsa-miR-3612	CLIP-seq
MIRT766413	hsa-miR-3654	CLIP-seq
MIRT766416	hsa-miR-4279	CLIP-seq
MIRT766418	hsa-miR-4443	CLIP-seq
MIRT2383902	hsa-miR-4727-5p	CLIP-seq
MIRT766431	hsa-miR-650	CLIP-seq
MIRT2435201	hsa-miR-193a-3p	CLIP-seq
MIRT2435202	hsa-miR-193b	CLIP-seq
MIRT2435203	hsa-miR-3158-5p	CLIP-seq
MIRT2435204	hsa-miR-892b	CLIP-seq
MIRT2469810	hsa-miR-1254	CLIP-seq
MIRT2469811	hsa-miR-3116	CLIP-seq
MIRT2469812	hsa-miR-4686	CLIP-seq
MIRT2383902	hsa-miR-4727-5p	CLIP-seq
MIRT2469813	hsa-miR-661	CLIP-seq
MIRT2469810	hsa-miR-1254	CLIP-seq
MIRT2469811	hsa-miR-3116	CLIP-seq
MIRT2674436	hsa-miR-4643	CLIP-seq
MIRT2469812	hsa-miR-4686	CLIP-seq
MIRT2383902	hsa-miR-4727-5p	CLIP-seq
MIRT2674437	hsa-miR-642b	CLIP-seq
MIRT2469813	hsa-miR-661	CLIP-seq
MIRT2674438	hsa-miR-7	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004175	Function	Endopeptidase activity	ISS
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0007520	Process	Myoblast fusion	IEA
GO:0007520	Process	Myoblast fusion	ISS
GO:0008201	Function	Heparin binding	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009986	Component	Cell surface	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	IEA
GO:0022617	Process	Extracellular matrix disassembly	ISS
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0050840	Function	Extracellular matrix binding	IEA

Other IDs

• MIM: 607509
• HGNC: 16305
• e!Ensembl: ENSG00000166106

Protein

• UniProt ID: Q8TE58
• Protein name: A disintegrin and metalloproteinase with thrombospondin motifs 15 (ADAM-TS 15) (ADAM-TS15) (ADAMTS-15) (EC 3.4.24.-)
• Protein function: Metalloprotease which has proteolytic activity against the proteoglycan VCAN, cleaving it at the 'Glu-1428-|-1429-Ala' site. Cleaves VCAN in the pericellular matrix surrounding myoblasts, facilitating myoblast contact and fusion which is require
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01562	Pep_M12B_propep	24 → 157	Reprolysin family propeptide	Family
  PF01421	Reprolysin	218 → 427	Reprolysin (M12B) family zinc metalloprotease	Domain
  PF17771	ADAM_CR_2	438 → 505	ADAM cysteine-rich domain	Domain
  PF00090	TSP_1	520 → 570	Thrombospondin type 1 domain	Domain
  PF05986	ADAM_spacer1	683 → 801	ADAM-TS Spacer 1	Family
  PF19030	TSP1_ADAMTS	843 → 894		Domain
  PF19030	TSP1_ADAMTS	897 → 950		Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in fetal liver and kidney, but not in any of the adult tissues examined. {ECO:0000269|PubMed:11867212}.
• Sequence:

  MLLLGILTLAFAGRTAGGSEPEREVVVPIRLDPDINGRRYYWRGPEDSGDQGLIFQITAF
  QEDFYLHLTPDAQFLAPAFSTEHLGVPLQGLTGGSSDLRRCFYSGDVNAEPDSFAAVSLC
  GGLRGAFGYRGAEYVISPLPNASAPAAQRNSQGAHLLQRRGVPGGPSGDPTSRCGVASGW
  NPAILRALDPYKPRRAGFGESRSRRRSGRAKRFVSIPRYVETLVVADESMVKFHGADLEH
  YLLTLLATAARLYRHPSILNPINIVVVKVLLLRDRDSGPKVTGNAALTLRNFCAWQKKLN
  KVSDKHPEYWDTAILFTRQDLCGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPSAFTTA
  HELGHVFNMPHDNVKVCEEVFGKLRANHMMSPTLIQIDRANPWSACSAAIITDFLDSGHG
  DCLLDQPSKPISLPEDLPGASYTLSQQCELAFGVGSKPCPYMQYCTKLWCTGKAKGQMVC
  QTRHFPWADGTSCGEGKLCLKGACVERHNLNKHRVDGSWAKWDPYGPCSRTCGGGVQLAR
  RQCTNPTPANGGKYCEGVRVKYRSCNLEPCPSSASGKSFREEQCEAFNGYNHSTNRLTLA
  VAWVPKYSGVSPRDKCKLICRANGTGYFYVLAPKVVDGTLCSPDSTSVCVQGKCIKAGCD
  GNLGSKKRFDKCGVCGGDNKSCKKVTGLFTKPMHGYNFVVAIPAGASSIDIRQRGYKGLI
  GDDNYLALKNSQGKYLLNGHFVVSAVERDLVVKGSLLRYSGTGTAVESLQASRPILEPLT
  VEVLSVGKMTPPRVRYSFYLPKEPREDKSSHPKDPRGPSVLHNSVLSLSNQVEQPDDRPP
  ARWVAGSWGPCSASCGSGLQKRAVDCRGSAGQRTVPACDAAHRPVETQACGEPCPTWELS
  AWSPCSKSCGRGFQRRSLKCVGHGGRLLARDQCNLHRKPQELDFCVLRPC

• Sequence length: 950

Pathways

Reactome:

Defective B3GALTL causes Peters-plus syndrome (PpS)
O-glycosylation of TSR domain-containing proteins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Arthrogryposis, distal, type 12	Pathogenic; Likely pathogenic	rs2541520331, rs900442449, rs754451064, rs2541545118	RCV003337697 RCV003337698 RCV003337699 RCV003337700	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHROGRYPOSIS, DISTAL, TYPE 2B	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISTAL ARTHROGRYPOSIS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	Pubtator	17088949	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16152618		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	36354023	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18671975	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37798683	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19458070		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19458070, 19844170		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	14730609		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36339449	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	28323982		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37073135	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	19180493	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	25649796		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	37875354	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37073135	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31151932		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19458070		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19458070		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19458070		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	14730609	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15599946		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	25142923	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31151932		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31151932	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	28323982		★☆☆☆☆ Found in Text Mining only