PSORS1C2 (psoriasis susceptibility 1 candidate 2)

Gene

• Entrez ID: 170680
• Gene name: Psoriasis susceptibility 1 candidate 2
• Gene symbol: PSORS1C2
• Synonyms (NCBI Gene): C6orf17, SPR1
• Chromosome: 6
• Chromosome location: 6p21.33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT711690	hsa-miR-490-5p	HITS-CLIP	19536157
MIRT711689	hsa-miR-1468-5p	HITS-CLIP	19536157
MIRT711690	hsa-miR-490-5p	HITS-CLIP	19536157
MIRT711689	hsa-miR-1468-5p	HITS-CLIP	19536157
MIRT1271076	hsa-miR-1254	CLIP-seq
MIRT1271077	hsa-miR-1270	CLIP-seq
MIRT1271078	hsa-miR-1292	CLIP-seq
MIRT1271079	hsa-miR-3116	CLIP-seq
MIRT1271080	hsa-miR-4254	CLIP-seq
MIRT1271081	hsa-miR-4471	CLIP-seq
MIRT1271082	hsa-miR-4646-5p	CLIP-seq
MIRT1271083	hsa-miR-4683	CLIP-seq
MIRT1271084	hsa-miR-4708-5p	CLIP-seq
MIRT1271085	hsa-miR-550a	CLIP-seq
MIRT1271086	hsa-miR-620	CLIP-seq
MIRT1271087	hsa-miR-661	CLIP-seq
MIRT1271076	hsa-miR-1254	CLIP-seq
MIRT1271077	hsa-miR-1270	CLIP-seq
MIRT1271078	hsa-miR-1292	CLIP-seq
MIRT1271079	hsa-miR-3116	CLIP-seq
MIRT1271080	hsa-miR-4254	CLIP-seq
MIRT1271081	hsa-miR-4471	CLIP-seq
MIRT1271082	hsa-miR-4646-5p	CLIP-seq
MIRT1271083	hsa-miR-4683	CLIP-seq
MIRT1271084	hsa-miR-4708-5p	CLIP-seq
MIRT1271085	hsa-miR-550a	CLIP-seq
MIRT1271086	hsa-miR-620	CLIP-seq
MIRT1271087	hsa-miR-661	CLIP-seq
MIRT1271076	hsa-miR-1254	CLIP-seq
MIRT1271077	hsa-miR-1270	CLIP-seq
MIRT1271078	hsa-miR-1292	CLIP-seq
MIRT1271079	hsa-miR-3116	CLIP-seq
MIRT1271080	hsa-miR-4254	CLIP-seq
MIRT1271081	hsa-miR-4471	CLIP-seq
MIRT1271082	hsa-miR-4646-5p	CLIP-seq
MIRT1271083	hsa-miR-4683	CLIP-seq
MIRT1271084	hsa-miR-4708-5p	CLIP-seq
MIRT1271085	hsa-miR-550a	CLIP-seq
MIRT1271086	hsa-miR-620	CLIP-seq
MIRT1271087	hsa-miR-661	CLIP-seq
MIRT1271076	hsa-miR-1254	CLIP-seq
MIRT1271077	hsa-miR-1270	CLIP-seq
MIRT1271078	hsa-miR-1292	CLIP-seq
MIRT1271079	hsa-miR-3116	CLIP-seq
MIRT1271080	hsa-miR-4254	CLIP-seq
MIRT1271081	hsa-miR-4471	CLIP-seq
MIRT1271082	hsa-miR-4646-5p	CLIP-seq
MIRT1271083	hsa-miR-4683	CLIP-seq
MIRT1271084	hsa-miR-4708-5p	CLIP-seq
MIRT1271085	hsa-miR-550a	CLIP-seq
MIRT1271086	hsa-miR-620	CLIP-seq
MIRT1271087	hsa-miR-661	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA

Other IDs

• MIM: 613526
• HGNC: 17199
• e!Ensembl: ENSG00000204538

Protein

• UniProt ID: Q9UIG4
• Protein name: Psoriasis susceptibility 1 candidate gene 2 protein (Protein SPR1)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15356	SPR1	23 → 136	Psoriasis susceptibility locus 2	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in skin. Also expressed in heart and skeletal muscle. {ECO:0000269|PubMed:12930300}.
• Sequence:

  MILNWKLLGILVLCLHTRGISGSEGHPSHPPAEDREEAGSPTLPQGPPVPGDPWPGAPPL
  FEDPPPTRPSRPWRDLPETGVWLPEPPRTDPPQPPRPDDPWPAGPQPPENPWPPAPEVDN
  RPQEEPDLDPPREEYR

• Sequence length: 136

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	10501656		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10501656	Inhibit	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	30626913	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	35462437	Inhibit	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	23955597	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	34879060	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30626913		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	10501656		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10501656		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	CTD_human_DG	23955597		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	GWASDB_DG	23955597		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	23955597	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	37455203	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10501656		★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	GWASCAT_DG	30837455		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	27531006	Inhibit	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	12823445, 12930300		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	LHGDN	12930300, 15523160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	12823445		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	30626913		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	30626913	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASDB_DG	21750679		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASCAT_DG	21750679		★★☆☆☆ Found in Text Mining + Unknown/Other Associations