Gene Gene information from NCBI Gene database.
Entrez ID 170591
Gene name S100 calcium binding protein Z
Gene symbol S100Z
Synonyms (NCBI Gene)
Gm625S100-zeta
Chromosome 5
Chromosome location 5q13.3
Summary Members of the S100 protein family contain 2 calcium-binding EF-hands and exhibit cell-type specific expression patterns. For additional background information on S100 proteins, see MIM 114085.[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
8
miRTarBase ID miRNA Experiments Reference
MIRT017307 hsa-miR-335-5p Microarray 18185580
MIRT1324326 hsa-miR-3160-5p CLIP-seq
MIRT1324327 hsa-miR-3943 CLIP-seq
MIRT1324328 hsa-miR-515-5p CLIP-seq
MIRT2096223 hsa-miR-3202 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 11747429
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 11747429, 32296183
GO:0042802 Function Identical protein binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610103 30367 ENSG00000171643
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WXG8
Protein name Protein S100-Z (S100 calcium-binding protein Z)
PDB 5HYD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 5 47 S-100/ICaBP type calcium binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Highest level of expression in spleen and leukocytes. {ECO:0000269|PubMed:11747429}.
Sequence
MPTQLEMAMDTMIRIFHRYSGKERKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQ
DLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKKGK
Sequence length 99
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CELIAC DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 33546025 Associate
★☆☆☆☆
Found in Text Mining only
Intervertebral Disc Degeneration Intervertebral disc disease Pubtator 36081453 Associate
★☆☆☆☆
Found in Text Mining only
Leukemia, Myelocytic, Acute Leukemia GWASCAT_DG 27903959
★☆☆☆☆
Found in Text Mining only