Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	170463
Gene name	Single stranded DNA binding protein 4
Gene symbol	SSBP4
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19p13.11

Show/Hide all (43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT563720	hsa-miR-3662	PAR-CLIP	20371350
MIRT081449	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT081452	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT081458	hsa-miR-5007-5p	PAR-CLIP	20371350
MIRT081456	hsa-miR-3163	PAR-CLIP	20371350
MIRT563719	hsa-miR-6841-3p	PAR-CLIP	20371350
MIRT563718	hsa-miR-1915-5p	PAR-CLIP	20371350
MIRT081453	hsa-miR-924	PAR-CLIP	20371350
MIRT406581	hsa-miR-6854-3p	PAR-CLIP	20371350
MIRT081461	hsa-miR-6830-3p	PAR-CLIP	20371350
MIRT563717	hsa-miR-502-5p	PAR-CLIP	20371350
MIRT563720	hsa-miR-3662	PAR-CLIP	20371350
MIRT081449	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT081452	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT081458	hsa-miR-5007-5p	PAR-CLIP	20371350
MIRT081456	hsa-miR-3163	PAR-CLIP	20371350
MIRT563719	hsa-miR-6841-3p	PAR-CLIP	20371350
MIRT563718	hsa-miR-1915-5p	PAR-CLIP	20371350
MIRT081453	hsa-miR-924	PAR-CLIP	20371350
MIRT406581	hsa-miR-6854-3p	PAR-CLIP	20371350
MIRT081461	hsa-miR-6830-3p	PAR-CLIP	20371350
MIRT563717	hsa-miR-502-5p	PAR-CLIP	20371350
MIRT1391661	hsa-miR-1207-3p	CLIP-seq
MIRT1391662	hsa-miR-1285	CLIP-seq
MIRT1391663	hsa-miR-296-5p	CLIP-seq
MIRT1391664	hsa-miR-3115	CLIP-seq
MIRT1391665	hsa-miR-3151	CLIP-seq
MIRT1391666	hsa-miR-3187-5p	CLIP-seq
MIRT1391667	hsa-miR-4447	CLIP-seq
MIRT1391668	hsa-miR-4472	CLIP-seq
MIRT1391669	hsa-miR-4640-3p	CLIP-seq
MIRT1391670	hsa-miR-4729	CLIP-seq
MIRT1391671	hsa-miR-4732-3p	CLIP-seq
MIRT1391672	hsa-miR-4758-3p	CLIP-seq
MIRT1391673	hsa-miR-491-5p	CLIP-seq
MIRT1391674	hsa-miR-612	CLIP-seq
MIRT2117293	hsa-miR-2115	CLIP-seq
MIRT1391664	hsa-miR-3115	CLIP-seq
MIRT1391670	hsa-miR-4729	CLIP-seq
MIRT2117294	hsa-miR-548aa	CLIP-seq
MIRT2117295	hsa-miR-548ac	CLIP-seq
MIRT2117296	hsa-miR-548d-3p	CLIP-seq
MIRT2117297	hsa-miR-548z	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 20211142, 21516116, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA

MIM	HGNC	e!Ensembl
607391	15676	ENSG00000130511

Q9BWG4

Protein name

Single-stranded DNA-binding protein 4

PDB

7OBX , 7OBY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04503	SSDP	82 → 360		Family

Sequence

MYAKGGKGSAVPSDSQAREKLALYVYEYLLHIGAQKSAQTFLSEIRWEKNITLGEPPGFL
HSWWCVFWDLYCAAPDRREACEHSGEAKAFQDYSAAAAPSPVMGSMAPGDTMAAGSMAAG
FFQGPPGSQPSPHNPNAPMMGPHGQPFMSPRFPGGPRPTLRMPSQPPAGLPGSQPLLPGA
MEPSPRAQGHPSMGGPMQRVTPPRGMASVGPQSYGGGMRPPPNSLAGPGLPAMNMGPGVR
GPWASPSGNSIPYSSSSPGSYTGPPGGGGPPGTPIMPSPGDSTNSSENMYTIMNPIGQGA
GRANFPLGPGPEGPMAAMSAMEPHHVNGSLGSGDMDGLPKSSPGAVAGLSNAPGTPRDDG
EMAAAGTFLHPFPSESYSPGMTMSV

Sequence length

385

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	29727689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SSBP4 (single stranded DNA binding protein 4)