PWWP2B (PWWP domain containing 2B)

Gene

• Entrez ID: 170394
• Gene name: PWWP domain containing 2B
• Gene symbol: PWWP2B
• Synonyms (NCBI Gene): PWWP2, bA432J24.1, pp8607
• Chromosome: 10
• Chromosome location: 10q26.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1278773	hsa-miR-15a	CLIP-seq
MIRT1278774	hsa-miR-15b	CLIP-seq
MIRT1278775	hsa-miR-16	CLIP-seq
MIRT1278776	hsa-miR-1827	CLIP-seq
MIRT1278777	hsa-miR-195	CLIP-seq
MIRT1278778	hsa-miR-3180	CLIP-seq
MIRT1278779	hsa-miR-3180-3p	CLIP-seq
MIRT1278780	hsa-miR-3196	CLIP-seq
MIRT1278781	hsa-miR-424	CLIP-seq
MIRT1278782	hsa-miR-4326	CLIP-seq
MIRT1278783	hsa-miR-4436b-3p	CLIP-seq
MIRT1278784	hsa-miR-4481	CLIP-seq
MIRT1278785	hsa-miR-4530	CLIP-seq
MIRT1278786	hsa-miR-4685-5p	CLIP-seq
MIRT1278787	hsa-miR-4691-5p	CLIP-seq
MIRT1278788	hsa-miR-4738-5p	CLIP-seq
MIRT1278789	hsa-miR-4745-5p	CLIP-seq
MIRT1278790	hsa-miR-4747-5p	CLIP-seq
MIRT1278791	hsa-miR-4758-5p	CLIP-seq
MIRT1278792	hsa-miR-497	CLIP-seq
MIRT1278793	hsa-miR-512-5p	CLIP-seq
MIRT1278794	hsa-miR-541	CLIP-seq
MIRT1278795	hsa-miR-654-5p	CLIP-seq
MIRT1278796	hsa-miR-765	CLIP-seq
MIRT1278797	hsa-miR-4270	CLIP-seq
MIRT1278798	hsa-miR-4441	CLIP-seq
MIRT2082154	hsa-miR-1228	CLIP-seq
MIRT2082155	hsa-miR-1266	CLIP-seq
MIRT1278773	hsa-miR-15a	CLIP-seq
MIRT1278774	hsa-miR-15b	CLIP-seq
MIRT1278775	hsa-miR-16	CLIP-seq
MIRT1278776	hsa-miR-1827	CLIP-seq
MIRT1278777	hsa-miR-195	CLIP-seq
MIRT2082156	hsa-miR-214	CLIP-seq
MIRT2082157	hsa-miR-224	CLIP-seq
MIRT2082158	hsa-miR-24	CLIP-seq
MIRT2082159	hsa-miR-3127-5p	CLIP-seq
MIRT2082160	hsa-miR-342-3p	CLIP-seq
MIRT2082161	hsa-miR-3619-5p	CLIP-seq
MIRT2082162	hsa-miR-378g	CLIP-seq
MIRT2082163	hsa-miR-3918	CLIP-seq
MIRT1278781	hsa-miR-424	CLIP-seq
MIRT2082164	hsa-miR-4436a	CLIP-seq
MIRT2082165	hsa-miR-4437	CLIP-seq
MIRT2082166	hsa-miR-4518	CLIP-seq
MIRT2082167	hsa-miR-4529-5p	CLIP-seq
MIRT1278785	hsa-miR-4530	CLIP-seq
MIRT2082168	hsa-miR-4674	CLIP-seq
MIRT2082169	hsa-miR-4733-3p	CLIP-seq
MIRT1278788	hsa-miR-4738-5p	CLIP-seq
MIRT1278792	hsa-miR-497	CLIP-seq
MIRT2082170	hsa-miR-665	CLIP-seq
MIRT2082171	hsa-miR-761	CLIP-seq
MIRT2082172	hsa-miR-764	CLIP-seq
MIRT1278796	hsa-miR-765	CLIP-seq
MIRT2082170	hsa-miR-665	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 30228260, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006338	Process	Chromatin remodeling	ISS
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	IEA
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	ISS
GO:0120161	Process	Regulation of cold-induced thermogenesis	IEA
GO:0120161	Process	Regulation of cold-induced thermogenesis	ISS
GO:0120325	Function	NuRD complex binding	IDA	30228260
GO:0120325	Function	NuRD complex binding	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q6NUJ5
• Protein name: PWWP domain-containing protein 2B
• Protein function: Chromatin-binding protein that acts as an adapter between distinct nucleosome components (H3K36me3 or H2A.Z) and chromatin-modifying complexes, contributing to the regulation of the levels of histone acetylation at actively transcribed genes (Pu
• PDB: 4LD6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00855	PWWP	488 → 576	PWWP domain	Domain

• Sequence:

  MEPRAGCRLPVRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDES
  PVNDSHGRAPEEGDAEVMQLGSSSPPPARGVQPPETTRPEPPPPLVPPLPAGSLPPYPPY
  FEGAPFPHPLWLRDTYKLWVPQPPPRTIKRTRRRLSRNRDPGRLILSTIRLRPRQVLCEK
  CKSTLSPPEASPGPPAAPRARRRLGSGPDRELRKPEEPENGEPTAAATARRSKRERREED
  RAPAEQVPRSPVIKISYSTPQGKGEVVKIPSRVHGSLEPFRPQQAPQDDGSQDPEVLDRE
  SRDRPSCAPSASIPKLKLTRPVPAGADLPPPKIRLKPHRLGDSEHEPVYRAELVGELNGY
  LRDSSPAPCADGPAGGLADLSSGSSGEDDDFKSCPQGPQGREGLAFLVSCPEGRADCASE
  SACSSDSLDEARSSGSEGTPADTGDLSPGHGASAPSVSREARQTVPPLTVRLHTQSVSEC
  ITEDGRTVAVGDIVWGKIHGFPWWPARVLDISLGQKEDGEPSWREAKVSWFGSPTTSFLS
  ISKLSPFSEFFKLRFNRKKKGMYRKAITEAANAARHVAPEIRELLTQFET

• Sequence length: 590

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35582821	Associate	★☆☆☆☆ Found in Text Mining only