OIT3 (oncoprotein induced transcript 3)

Gene

• Entrez ID: 170392
• Gene name: Oncoprotein induced transcript 3
• Gene symbol: OIT3
• Synonyms (NCBI Gene): LZP
• Chromosome: 10
• Chromosome location: 10q22.1
• Summary: This gene was identified due to its downregulation in hepatocarcinomas. The encoded protein may be involved in liver development and function. [provided by RefSeq, Sep 2016]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT449981	hsa-miR-296-3p	PAR-CLIP	22100165
MIRT449980	hsa-miR-5087	PAR-CLIP	22100165
MIRT449979	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT449981	hsa-miR-296-3p	PAR-CLIP	22100165
MIRT449980	hsa-miR-5087	PAR-CLIP	22100165
MIRT449979	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT1202925	hsa-miR-202	CLIP-seq
MIRT1202926	hsa-miR-4280	CLIP-seq
MIRT1202927	hsa-miR-4496	CLIP-seq
MIRT1202928	hsa-miR-4678	CLIP-seq
MIRT1202929	hsa-miR-595	CLIP-seq
MIRT2585160	hsa-miR-219-1-3p	CLIP-seq
MIRT2585161	hsa-miR-3174	CLIP-seq
MIRT2585162	hsa-miR-3907	CLIP-seq
MIRT2585163	hsa-miR-4731-5p	CLIP-seq
MIRT2585164	hsa-miR-571	CLIP-seq
MIRT2585165	hsa-miR-759	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003014	Process	Renal system process	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005615	Component	Extracellular space	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0009986	Component	Cell surface	IBA

Other IDs

• MIM: 609330
• HGNC: 29953
• e!Ensembl: ENSG00000138315

Protein

• UniProt ID: Q8WWZ8
• Protein name: Oncoprotein-induced transcript 3 protein (Liver-specific zona pellucida domain-containing protein)
• Protein function: May be involved in hepatocellular function and development.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14670	FXa_inhibition	186 → 221		Domain
  PF14670	FXa_inhibition	227 → 262		Domain
  PF00100	Zona_pellucida	268 → 514	Zona pellucida-like domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Liver-specific. Expressed only in the hepatocytes. Down-regulated in hepatocellular carcinoma (HCC) and HCC cell lines. {ECO:0000269|PubMed:12939600}.
• Sequence:

  MPPFLLLTCLFITGTSVSPVALDPCSAYISLNEPWRNTDHQLDESQGPPLCDNHVNGEWY
  HFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEGDGIVQRQACASFNGNCCLWNTTVE
  VKACPGGYYVYRLTKPSVCFHVYCGHFYDICDEDCHGSCSDTSECTCAPGTVLGPDRQTC
  FDENECEQNNGGCSEICVNLKNSYRCECGVGRVLRSDGKTCEDVEGCHNNNGGCSHSCLG
  SEKGYQCECPRGLVLSEDNHTCQVPVLCKSNAIEVNIPRELVGGLELFLTNTSCRGVSNG
  THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDFIIRTSKLLIPVTCEFPR
  LYTISEGYVPNLRNSPLEIMSRNHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGI
  EPVVHVSGLESLVESCFATPTSKIDEVLKYYLIRDGCVSDDSVKQYTSRDHLAKHFQVPV
  FKFVGKDHKEVFLHCRVLVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQGQTLTGGPIR
  IDWED

• Sequence length: 545

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anaplasia	Anaplasia	BEFREE	12939600		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35353239	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35353239	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	32569156	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	LHGDN	15589826		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12939600		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25824785		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25824785		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25824785	Associate	★☆☆☆☆ Found in Text Mining only