Gene Gene information from NCBI Gene database.
Entrez ID 169200
Gene name Transmembrane protein 64
Gene symbol TMEM64
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8q21.3
miRNA miRNA information provided by mirtarbase database.
1080
miRTarBase ID miRNA Experiments Reference
MIRT021188 hsa-miR-186-5p Sequencing 20371350
MIRT024154 hsa-miR-221-3p Sequencing 20371350
MIRT025195 hsa-miR-181a-5p Sequencing 20371350
MIRT052443 hsa-let-7a-5p CLASH 23622248
MIRT044411 hsa-miR-320a CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0005783 Component Endoplasmic reticulum IBA
GO:0005783 Component Endoplasmic reticulum IEA
GO:0016020 Component Membrane IEA
GO:0030316 Process Osteoclast differentiation IEA
GO:0045600 Process Positive regulation of fat cell differentiation IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620429 25441 ENSG00000180694
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6YI46
Protein name Transmembrane protein 64
Protein function Positively regulates TNFSF11-induced osteoclast differentiation. Acts as a regulator of TNFSF11-mediated Ca(2+) signaling pathways via its interaction with SERCA2 which is critical for the TNFSF11-induced CREB1 activation and mitochondrial ROS g
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09335 SNARE_assoc 172 295 SNARE associated Golgi protein Family
Sequence
MRSPGGILLQALPRLLQHAALPGLAELPARWALPRGAGGDGPADRLPRGGGASAAAAAAA
ASGALLGAYLERHGPPEASELPEPGGALAGGPGSGGGGVVVGVAEVRNWRCCCLGSTCWC
RSLVLVCVLAALCFASLALVRRYLHHLLLWVESLDSLLGVLLFVVGFIVVSFPCGWGYIV
LNVAAGYLYGFVLGMGLMMVGVLIGTFIAHVVCKRLLTAWVAARIQSSEKLSAVIRVVEG
GSGLKVVALARLTPIPFGLQNAVFSITDLSLPNYLMASSVGLLPTQLLNSYLGTT
LRTME
DVIAEQSVSGYFVFCLQIIISIGLMFYVVHRAQVELNAAIVACEMELKSSLVKGNQPNTS
GSSFYNKRTLTFSGGGINVV
Sequence length 380
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Osteoclast differentiation  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Neoplasms Breast neoplasm Pubtator 35436939 Associate
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 38232867 Stimulate
★☆☆☆☆
Found in Text Mining only
Osteoporosis Osteoporosis BEFREE 31814858
★☆☆☆☆
Found in Text Mining only
Prostatic Neoplasms Prostatic Neoplasms BEFREE 31289498
★☆☆☆☆
Found in Text Mining only