Gene Gene information from NCBI Gene database.
Entrez ID 168374
Gene name Zinc finger protein 92
Gene symbol ZNF92
Synonyms (NCBI Gene)
HEL-203HPF12HTF12TF12
Chromosome 7
Chromosome location 7q11.21
miRNA miRNA information provided by mirtarbase database.
143
miRTarBase ID miRNA Experiments Reference
MIRT020082 hsa-miR-361-5p Sequencing 20371350
MIRT025985 hsa-miR-148a-3p Sequencing 20371350
MIRT1542614 hsa-miR-1229 CLIP-seq
MIRT1542615 hsa-miR-1238 CLIP-seq
MIRT1542616 hsa-miR-1297 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity NAS 2023909
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603974 13168 ENSG00000146757
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q03936
Protein name Zinc finger protein 92 (Zinc finger protein HTF12)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 3 44 KRAB box Family
PF00096 zf-C2H2 201 223 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 229 251 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 257 279 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 285 307 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 341 363 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 369 391 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 397 419 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 425 447 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 453 475 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 481 503 Zinc finger, C2H2 type Domain
Sequence
MGPLTFRDVKIEFSLEEWQCLDTAQRNLYRDVMLENYRNLVFLGIAVSKPDLITWLEQGK
EPWNLKRHEMVDKTPVMCSHFAQDVWPEHSIKDSFQKVILRTYGKYGHENLQLRKDHKSV
DACKVYKGGYNGLNQCLTTTDSKIFQCDKYVKVFHKFPNVNRNKIRHTGKKPFKCKNRGK
SFCMLSQLTQHKKIHTREYSYKCEECGKAFNWSSTLTKHKIIHTGEKPYKCEECGKAFNR
SSNLTKHKIIH
TGEKPYKCEECGKAFNRSSTLTKHKRIHTEEKPYKCEECGKAFNQFSIL
NKHKRIH
MEDKPYKCEECGKAFRVFSILKKHKIIHTGEKPYKCEECGKAFNQFSNLTKHK
IIH
TGEKPYKCDECGKAFNQSSTLTKHKRIHTGEKPYKCEECGKAFKQSSTLTEHKIIHT
GEKPYKCEKCGKAFSWSSAFTKHKRNHMEDKPYKCEECGKAFSVFSTLTKHKIIHTREKP
YKCEECGKAFNQSSIFTKHKIIHTEGKSYKCEKCGNAFNQSSNLTARKIIYTGEKPYKYE
ECDKAFNKFSTLITHQIIYTGEKPCKHECGRAFNKSSNYTKEKLQT
Sequence length 586
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anxiety Anxiety Disorder BEFREE 27683300
★☆☆☆☆
Found in Text Mining only
Anxiety Disorders Anxiety Disorder BEFREE 27683300
★☆☆☆☆
Found in Text Mining only
Bipolar Disorder Bipolar disorder Pubtator 35881528 Associate
★☆☆☆☆
Found in Text Mining only
Depressive disorder Mental Depression BEFREE 27683300
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer BEFREE 23674207, 25252911
★☆☆☆☆
Found in Text Mining only
Mental Depression Mental Depression BEFREE 27683300
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 23674207
★☆☆☆☆
Found in Text Mining only
Prostate carcinoma Prostate cancer BEFREE 23674207, 25252911
★☆☆☆☆
Found in Text Mining only