Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	167465
Gene name	Zinc finger protein 366
Gene symbol	ZNF366
Synonyms (NCBI Gene)	DC-SCRIPTDCSCRIPT
Chromosome	5
Chromosome location	5q13.2\|5q13.2

Show/Hide all (77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT517770	hsa-miR-3936	PAR-CLIP	22012620
MIRT517767	hsa-miR-3154	PAR-CLIP	22012620
MIRT517766	hsa-miR-3925-5p	PAR-CLIP	22012620
MIRT517765	hsa-miR-3123	PAR-CLIP	22012620
MIRT517755	hsa-miR-411-5p	PAR-CLIP	22012620
MIRT517763	hsa-miR-3179	PAR-CLIP	22012620
MIRT517762	hsa-miR-6770-5p	PAR-CLIP	22012620
MIRT517761	hsa-miR-193b-5p	PAR-CLIP	22012620
MIRT517760	hsa-miR-6832-5p	PAR-CLIP	22012620
MIRT517759	hsa-miR-19a-5p	PAR-CLIP	22012620
MIRT517758	hsa-miR-19b-1-5p	PAR-CLIP	22012620
MIRT517757	hsa-miR-19b-2-5p	PAR-CLIP	22012620
MIRT517755	hsa-miR-411-5p	PAR-CLIP	22012620
MIRT517754	hsa-miR-3064-3p	PAR-CLIP	22012620
MIRT517753	hsa-miR-4715-3p	PAR-CLIP	22012620
MIRT517752	hsa-miR-4776-3p	PAR-CLIP	22012620
MIRT517770	hsa-miR-3936	PAR-CLIP	23446348
MIRT517768	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT517767	hsa-miR-3154	PAR-CLIP	23446348
MIRT517766	hsa-miR-3925-5p	PAR-CLIP	23446348
MIRT517765	hsa-miR-3123	PAR-CLIP	23446348
MIRT517755	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT517764	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT517763	hsa-miR-3179	PAR-CLIP	23446348
MIRT517762	hsa-miR-6770-5p	PAR-CLIP	23446348
MIRT517761	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT517760	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT517759	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT517758	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT517757	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT517756	hsa-miR-4775	PAR-CLIP	23446348
MIRT517755	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT517754	hsa-miR-3064-3p	PAR-CLIP	23446348
MIRT517753	hsa-miR-4715-3p	PAR-CLIP	23446348
MIRT517752	hsa-miR-4776-3p	PAR-CLIP	23446348
MIRT517751	hsa-miR-3149	PAR-CLIP	23446348
MIRT517770	hsa-miR-3936	PAR-CLIP	22012620
MIRT517767	hsa-miR-3154	PAR-CLIP	22012620
MIRT517766	hsa-miR-3925-5p	PAR-CLIP	22012620
MIRT517765	hsa-miR-3123	PAR-CLIP	22012620
MIRT517755	hsa-miR-411-5p	PAR-CLIP	22012620
MIRT517763	hsa-miR-3179	PAR-CLIP	22012620
MIRT517762	hsa-miR-6770-5p	PAR-CLIP	22012620
MIRT517761	hsa-miR-193b-5p	PAR-CLIP	22012620
MIRT517760	hsa-miR-6832-5p	PAR-CLIP	22012620
MIRT517759	hsa-miR-19a-5p	PAR-CLIP	22012620
MIRT517758	hsa-miR-19b-1-5p	PAR-CLIP	22012620
MIRT517757	hsa-miR-19b-2-5p	PAR-CLIP	22012620
MIRT517755	hsa-miR-411-5p	PAR-CLIP	22012620
MIRT517754	hsa-miR-3064-3p	PAR-CLIP	22012620
MIRT517753	hsa-miR-4715-3p	PAR-CLIP	22012620
MIRT517752	hsa-miR-4776-3p	PAR-CLIP	22012620
MIRT517770	hsa-miR-3936	PAR-CLIP	23446348
MIRT517768	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT517767	hsa-miR-3154	PAR-CLIP	23446348
MIRT517766	hsa-miR-3925-5p	PAR-CLIP	23446348
MIRT517765	hsa-miR-3123	PAR-CLIP	23446348
MIRT517755	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT517764	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT517763	hsa-miR-3179	PAR-CLIP	23446348
MIRT517762	hsa-miR-6770-5p	PAR-CLIP	23446348
MIRT517761	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT517760	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT517759	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT517758	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT517757	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT517756	hsa-miR-4775	PAR-CLIP	23446348
MIRT517755	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT517754	hsa-miR-3064-3p	PAR-CLIP	23446348
MIRT517753	hsa-miR-4715-3p	PAR-CLIP	23446348
MIRT517752	hsa-miR-4776-3p	PAR-CLIP	23446348
MIRT517751	hsa-miR-3149	PAR-CLIP	23446348
MIRT1523227	hsa-miR-3545-3p	CLIP-seq
MIRT1523228	hsa-miR-3611	CLIP-seq
MIRT1523229	hsa-miR-3667-5p	CLIP-seq
MIRT1523230	hsa-miR-4725-5p	CLIP-seq
MIRT1523231	hsa-miR-504	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	17085477
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	17085477
GO:0005515	Function	Protein binding	IPI	17085477, 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	17085477
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0030331	Function	Nuclear estrogen receptor binding	IBA
GO:0030331	Function	Nuclear estrogen receptor binding	IDA	17085477
GO:0033147	Process	Negative regulation of intracellular estrogen receptor signaling pathway	IBA
GO:0033147	Process	Negative regulation of intracellular estrogen receptor signaling pathway	IDA	17085477
GO:0043627	Process	Response to estrogen	IBA
GO:0043627	Process	Response to estrogen	IDA	17085477
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
610159	18316	ENSG00000178175

Q8N895

Protein name

Zinc finger protein 366 (Dendritic cell-specific transcript protein) (DC-SCRIPT)

Protein function

Has transcriptional repression activity. Acts as a corepressor of ESR1; the function seems to involve CTBP1 and histone deacetylases.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	253 → 275	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	309 → 331	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	337 → 359	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	366 → 387	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	393 → 415	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	421 → 443	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	449 → 471	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	477 → 499	Zinc finger, C2H2 type	Domain
PF13912	zf-C2H2_6	505 → 530		Domain
PF00096	zf-C2H2	533 → 556	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in immature and mature dendritic cells (DCs). Not detected in other blood cell types. {ECO:0000269|PubMed:16393996}.

Sequence

MQKEMKMIKDEDVHFDLAVKKTPSFPHCLQPVASRGKAPQRHPFPEALRGPFSQFRYEPP
PGDLDGFPGVFEGAGSRKRKSMPTKMPYNHPAEEVTLALHSEENKNHGLPNLPLLFPQPP
RPKYDSQMIDLCNVGFQFYRSLEHFGGKPVKQEPIKPSAVWPQPTPTPFLPTPYPYYPKV
HPGLMFPFFVPSSSPFPFSRHTFLPKQPPEPLLPRKAEPQESEETKQKVERVDVNVQIDD
SYYVDVGGSQKRWQCPTCEKSYTSKYNLVTHILGHSGIKPHACTHCGKLFKQLSHLHTHM
LTHQGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVKPHNCRVCGRGFAYPSELKAHEAKHA
SGRENICVECGLDFPTLAQLKRHLTTHRGPIQYNCSECDKTFQYPSQLQNHMMKHKDIRP
YICSECGMEFVQPHHLKQHSLTHKGVKEHKCGICGREFTLLANMKRHVLIHTNIRAYQCH
LCYKSFVQKQTLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGHMHLHSDSKPFKCLYCPS
KFTLKGNLTRHMKVKHGVMERGLHSQGLGRGRIALAQTAGVLRSLEQEEPFDLSQKRRAK
VPVFQSDGESAQGSHCHEEEEEDNCYEVEPYSPGLAPQSQQLCTPEDLSTKSEHAPEVLE
EACKEEKEDASKGEWEKRSKGDLGAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYF
KHRDESLKELLERKMEKQAVLLGI

Sequence length

744

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20008677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21122099, 22473304, 25663546, 25722978, 31265831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21122099, 25663546, 25722978	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrioma	Endometrioma	BEFREE	25722978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25722978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	25722978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	38103737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20008677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21122099, 22473304, 25663546, 25722978, 31265831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22473304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20008677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20008677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25663546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20008677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21122099, 25663546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	31265831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22473304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	19525478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF366 (zinc finger protein 366)