Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1665
Gene name	DEAH-box helicase 15
Gene symbol	DHX15
Synonyms (NCBI Gene)	DBP1DDX15PRP43PRPF43PrPp43phPrp43
Chromosome	4
Chromosome location	4p15.2
Summary	The protein encoded by this gene is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing. [provided by RefSeq, Jul 2008]

183

Show/Hide all (183)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002740	hsa-miR-1-3p	pSILAC	18668040
MIRT002740	hsa-miR-1-3p	Microarray	15685193
MIRT002740	hsa-miR-1-3p	Microarray;Other	15685193
MIRT002740	hsa-miR-1-3p	Proteomics	18668040
MIRT051549	hsa-let-7e-5p	CLASH	23622248
MIRT051549	hsa-let-7e-5p	CLASH	23622248
MIRT050083	hsa-miR-26a-5p	CLASH	23622248
MIRT046931	hsa-miR-221-3p	CLASH	23622248
MIRT043871	hsa-miR-378a-3p	CLASH	23622248
MIRT041781	hsa-miR-484	CLASH	23622248
MIRT935266	hsa-miR-1	CLIP-seq
MIRT935267	hsa-miR-1183	CLIP-seq
MIRT935268	hsa-miR-1298	CLIP-seq
MIRT935269	hsa-miR-1305	CLIP-seq
MIRT935270	hsa-miR-139-5p	CLIP-seq
MIRT935271	hsa-miR-145	CLIP-seq
MIRT935272	hsa-miR-186	CLIP-seq
MIRT935273	hsa-miR-206	CLIP-seq
MIRT935274	hsa-miR-3065-5p	CLIP-seq
MIRT935275	hsa-miR-3133	CLIP-seq
MIRT935276	hsa-miR-3143	CLIP-seq
MIRT935277	hsa-miR-3180-5p	CLIP-seq
MIRT935278	hsa-miR-3183	CLIP-seq
MIRT935279	hsa-miR-320a	CLIP-seq
MIRT935280	hsa-miR-320b	CLIP-seq
MIRT935281	hsa-miR-320c	CLIP-seq
MIRT935282	hsa-miR-320d	CLIP-seq
MIRT935283	hsa-miR-3607-3p	CLIP-seq
MIRT935284	hsa-miR-3618	CLIP-seq
MIRT935285	hsa-miR-382	CLIP-seq
MIRT935286	hsa-miR-3909	CLIP-seq
MIRT935287	hsa-miR-4263	CLIP-seq
MIRT935288	hsa-miR-4275	CLIP-seq
MIRT935289	hsa-miR-4429	CLIP-seq
MIRT935290	hsa-miR-4484	CLIP-seq
MIRT935291	hsa-miR-4509	CLIP-seq
MIRT935292	hsa-miR-4693-5p	CLIP-seq
MIRT935293	hsa-miR-4699-3p	CLIP-seq
MIRT935294	hsa-miR-4709-3p	CLIP-seq
MIRT935295	hsa-miR-4711-3p	CLIP-seq
MIRT935296	hsa-miR-4712-5p	CLIP-seq
MIRT935297	hsa-miR-4723-3p	CLIP-seq
MIRT935298	hsa-miR-4744	CLIP-seq
MIRT935299	hsa-miR-4753-5p	CLIP-seq
MIRT935300	hsa-miR-4775	CLIP-seq
MIRT935301	hsa-miR-4799-5p	CLIP-seq
MIRT935302	hsa-miR-505	CLIP-seq
MIRT935303	hsa-miR-543	CLIP-seq
MIRT935304	hsa-miR-548an	CLIP-seq
MIRT935305	hsa-miR-548v	CLIP-seq
MIRT935306	hsa-miR-556-5p	CLIP-seq
MIRT935307	hsa-miR-576-5p	CLIP-seq
MIRT935308	hsa-miR-592	CLIP-seq
MIRT935309	hsa-miR-599	CLIP-seq
MIRT935310	hsa-miR-610	CLIP-seq
MIRT935311	hsa-miR-613	CLIP-seq
MIRT935312	hsa-miR-770-5p	CLIP-seq
MIRT935313	hsa-miR-934	CLIP-seq
MIRT935266	hsa-miR-1	CLIP-seq
MIRT935268	hsa-miR-1298	CLIP-seq
MIRT935270	hsa-miR-139-5p	CLIP-seq
MIRT935271	hsa-miR-145	CLIP-seq
MIRT935273	hsa-miR-206	CLIP-seq
MIRT935274	hsa-miR-3065-5p	CLIP-seq
MIRT935277	hsa-miR-3180-5p	CLIP-seq
MIRT935279	hsa-miR-320a	CLIP-seq
MIRT935280	hsa-miR-320b	CLIP-seq
MIRT935281	hsa-miR-320c	CLIP-seq
MIRT935282	hsa-miR-320d	CLIP-seq
MIRT935288	hsa-miR-4275	CLIP-seq
MIRT1976915	hsa-miR-4329	CLIP-seq
MIRT935289	hsa-miR-4429	CLIP-seq
MIRT1976916	hsa-miR-4699-5p	CLIP-seq
MIRT935294	hsa-miR-4709-3p	CLIP-seq
MIRT935296	hsa-miR-4712-5p	CLIP-seq
MIRT935302	hsa-miR-505	CLIP-seq
MIRT935305	hsa-miR-548v	CLIP-seq
MIRT935306	hsa-miR-556-5p	CLIP-seq
MIRT935310	hsa-miR-610	CLIP-seq
MIRT935311	hsa-miR-613	CLIP-seq
MIRT935312	hsa-miR-770-5p	CLIP-seq
MIRT935266	hsa-miR-1	CLIP-seq
MIRT935268	hsa-miR-1298	CLIP-seq
MIRT935270	hsa-miR-139-5p	CLIP-seq
MIRT935271	hsa-miR-145	CLIP-seq
MIRT935273	hsa-miR-206	CLIP-seq
MIRT2212235	hsa-miR-23a	CLIP-seq
MIRT2212236	hsa-miR-23b	CLIP-seq
MIRT2212237	hsa-miR-23c	CLIP-seq
MIRT935274	hsa-miR-3065-5p	CLIP-seq
MIRT935276	hsa-miR-3143	CLIP-seq
MIRT2212238	hsa-miR-3168	CLIP-seq
MIRT935277	hsa-miR-3180-5p	CLIP-seq
MIRT935278	hsa-miR-3183	CLIP-seq
MIRT935279	hsa-miR-320a	CLIP-seq
MIRT935280	hsa-miR-320b	CLIP-seq
MIRT935281	hsa-miR-320c	CLIP-seq
MIRT935282	hsa-miR-320d	CLIP-seq
MIRT2212239	hsa-miR-34b	CLIP-seq
MIRT935284	hsa-miR-3618	CLIP-seq
MIRT935286	hsa-miR-3909	CLIP-seq
MIRT935287	hsa-miR-4263	CLIP-seq
MIRT935288	hsa-miR-4275	CLIP-seq
MIRT2212240	hsa-miR-4277	CLIP-seq
MIRT1976915	hsa-miR-4329	CLIP-seq
MIRT935289	hsa-miR-4429	CLIP-seq
MIRT1976916	hsa-miR-4699-5p	CLIP-seq
MIRT935294	hsa-miR-4709-3p	CLIP-seq
MIRT935295	hsa-miR-4711-3p	CLIP-seq
MIRT935296	hsa-miR-4712-5p	CLIP-seq
MIRT935297	hsa-miR-4723-3p	CLIP-seq
MIRT935301	hsa-miR-4799-5p	CLIP-seq
MIRT935302	hsa-miR-505	CLIP-seq
MIRT2212241	hsa-miR-513b	CLIP-seq
MIRT935303	hsa-miR-543	CLIP-seq
MIRT935305	hsa-miR-548v	CLIP-seq
MIRT935306	hsa-miR-556-5p	CLIP-seq
MIRT935308	hsa-miR-592	CLIP-seq
MIRT935309	hsa-miR-599	CLIP-seq
MIRT935310	hsa-miR-610	CLIP-seq
MIRT935311	hsa-miR-613	CLIP-seq
MIRT935312	hsa-miR-770-5p	CLIP-seq
MIRT935313	hsa-miR-934	CLIP-seq
MIRT935288	hsa-miR-4275	CLIP-seq
MIRT935302	hsa-miR-505	CLIP-seq
MIRT935266	hsa-miR-1	CLIP-seq
MIRT935269	hsa-miR-1305	CLIP-seq
MIRT935272	hsa-miR-186	CLIP-seq
MIRT2515945	hsa-miR-194	CLIP-seq
MIRT935273	hsa-miR-206	CLIP-seq
MIRT2212235	hsa-miR-23a	CLIP-seq
MIRT2212236	hsa-miR-23b	CLIP-seq
MIRT2212237	hsa-miR-23c	CLIP-seq
MIRT935274	hsa-miR-3065-5p	CLIP-seq
MIRT935275	hsa-miR-3133	CLIP-seq
MIRT935276	hsa-miR-3143	CLIP-seq
MIRT2212239	hsa-miR-34b	CLIP-seq
MIRT935284	hsa-miR-3618	CLIP-seq
MIRT935285	hsa-miR-382	CLIP-seq
MIRT935287	hsa-miR-4263	CLIP-seq
MIRT935288	hsa-miR-4275	CLIP-seq
MIRT935291	hsa-miR-4509	CLIP-seq
MIRT1976916	hsa-miR-4699-5p	CLIP-seq
MIRT935295	hsa-miR-4711-3p	CLIP-seq
MIRT935298	hsa-miR-4744	CLIP-seq
MIRT935301	hsa-miR-4799-5p	CLIP-seq
MIRT935302	hsa-miR-505	CLIP-seq
MIRT2212241	hsa-miR-513b	CLIP-seq
MIRT935303	hsa-miR-543	CLIP-seq
MIRT935307	hsa-miR-576-5p	CLIP-seq
MIRT935308	hsa-miR-592	CLIP-seq
MIRT935309	hsa-miR-599	CLIP-seq
MIRT935311	hsa-miR-613	CLIP-seq
MIRT935313	hsa-miR-934	CLIP-seq
MIRT935266	hsa-miR-1	CLIP-seq
MIRT935269	hsa-miR-1305	CLIP-seq
MIRT935272	hsa-miR-186	CLIP-seq
MIRT2515945	hsa-miR-194	CLIP-seq
MIRT935273	hsa-miR-206	CLIP-seq
MIRT2212235	hsa-miR-23a	CLIP-seq
MIRT2212236	hsa-miR-23b	CLIP-seq
MIRT2212237	hsa-miR-23c	CLIP-seq
MIRT935274	hsa-miR-3065-5p	CLIP-seq
MIRT935275	hsa-miR-3133	CLIP-seq
MIRT935276	hsa-miR-3143	CLIP-seq
MIRT2212239	hsa-miR-34b	CLIP-seq
MIRT935284	hsa-miR-3618	CLIP-seq
MIRT935285	hsa-miR-382	CLIP-seq
MIRT935287	hsa-miR-4263	CLIP-seq
MIRT935288	hsa-miR-4275	CLIP-seq
MIRT935291	hsa-miR-4509	CLIP-seq
MIRT1976916	hsa-miR-4699-5p	CLIP-seq
MIRT935295	hsa-miR-4711-3p	CLIP-seq
MIRT935298	hsa-miR-4744	CLIP-seq
MIRT935301	hsa-miR-4799-5p	CLIP-seq
MIRT935302	hsa-miR-505	CLIP-seq
MIRT2212241	hsa-miR-513b	CLIP-seq
MIRT935303	hsa-miR-543	CLIP-seq
MIRT935307	hsa-miR-576-5p	CLIP-seq
MIRT935308	hsa-miR-592	CLIP-seq
MIRT935309	hsa-miR-599	CLIP-seq
MIRT935311	hsa-miR-613	CLIP-seq
MIRT935313	hsa-miR-934	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000398	Process	MRNA splicing, via spliceosome	TAS
GO:0002376	Process	Immune system process	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	32179686
GO:0003723	Function	RNA binding	IEA
GO:0003724	Function	RNA helicase activity	IDA	32179686
GO:0003724	Function	RNA helicase activity	IEA
GO:0003724	Function	RNA helicase activity	TAS	7935475
GO:0003725	Function	Double-stranded RNA binding	IDA	21266579, 24990078
GO:0004386	Function	Helicase activity	IBA
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	17332742, 19644445, 22365833, 22569250, 24304693, 24965446, 24990078, 25416956, 26494172, 26871637, 28514442, 29021621, 32296183, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9388478
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IBA
GO:0005689	Component	U12-type spliceosomal complex	IDA	15146077
GO:0005730	Component	Nucleolus	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0006397	Process	MRNA processing	TAS	7935475
GO:0008186	Function	ATP-dependent activity, acting on RNA	TAS
GO:0008380	Process	RNA splicing	IC	15146077
GO:0008380	Process	RNA splicing	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	24990078
GO:0043279	Process	Response to alkaloid	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0051607	Process	Defense response to virus	IDA	24990078
GO:0051607	Process	Defense response to virus	IEA
GO:0071008	Component	U2-type post-mRNA release spliceosomal complex	IDA	19103666
GO:0140374	Process	Antiviral innate immune response	IDA	24990078
GO:0140374	Process	Antiviral innate immune response	IEA

MIM	HGNC	e!Ensembl
603403	2738	ENSG00000109606

O43143

Protein name

ATP-dependent RNA helicase DHX15 (EC 3.6.4.13) (ATP-dependent RNA helicase #46) (DEAH box protein 15) (Splicing factor Prp43) (hPrp43)

Protein function

RNA helicase involved in mRNA processing and antiviral innate immunity (PubMed:19103666, PubMed:19432882, PubMed:24782566, PubMed:24990078, PubMed:32179686, PubMed:34161762). Pre-mRNA processing factor involved in disassembly of spliceosomes aft

PDB

5XDR , 6ID1 , 6SH6 , 6SH7 , 8EJM , 8RO2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00270	DEAD	141 → 301	DEAD/DEAH box helicase	Domain
PF00271	Helicase_C	334 → 477	Helicase conserved C-terminal domain	Family
PF04408	HA2	539 → 627	Helicase associated domain (HA2)	Domain
PF07717	OB_NTP_bind	689 → 765	Oligonucleotide/oligosaccharide-binding (OB)-fold	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9388478}.

Sequence

MSKRHRLDLGEDYPSGKKRAGTDGKDRDRDRDREDRSKDRDRERDRGDREREREKEKEKE
LRASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTN
LPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRS
LPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGM
LLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKF
QIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQE
EIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVS
TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGK
CFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRAL
ELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCF
VRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNV
RQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQ
LHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQL
DRIIAKLQSKEYSQY

Sequence length

795

Interactions

View interactions

	KEGG		Reactome
	Spliceosome		mRNA Splicing - Major Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ASTIGMATISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PATENT DUCTUS ARTERIOSUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIVENTRICULAR HETEROTOPIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	29512921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	27798625, 29163777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	27798625, 29163777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30018118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36776048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	38056214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37101128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36177832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28829764		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	12379888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	25172939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31896782, 36459648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	27798625, 29163777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29163777, 31691804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30339968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	39743791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36177832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28991234, 30714180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27486320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28829764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia, Degenerative	Myopia	GWASCAT_DG	23049088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28829764, 30339968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30018118, 31739208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28991234, 30714180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30714180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27486320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29739919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DHX15 (DEAH-box helicase 15)