Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	1662
Gene name	DEAD-box helicase 10
Gene symbol	DDX10
Synonyms (NCBI Gene)	Dbp4HRH-J8
Chromosome	11
Chromosome location	11q22.3
Summary	DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and m

Show/Hide all (61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020829	hsa-miR-155-5p	Proteomics	18668040
MIRT025474	hsa-miR-34a-5p	Proteomics	21566225
MIRT027606	hsa-miR-98-5p	Microarray	19088304
MIRT028567	hsa-miR-30a-5p	Proteomics	18668040
MIRT032410	hsa-let-7b-5p	Proteomics	18668040
MIRT929633	hsa-miR-101	CLIP-seq
MIRT929634	hsa-miR-1261	CLIP-seq
MIRT929635	hsa-miR-1273d	CLIP-seq
MIRT929636	hsa-miR-144	CLIP-seq
MIRT929637	hsa-miR-3182	CLIP-seq
MIRT929638	hsa-miR-3647-3p	CLIP-seq
MIRT929639	hsa-miR-3686	CLIP-seq
MIRT929640	hsa-miR-3914	CLIP-seq
MIRT929641	hsa-miR-4474-5p	CLIP-seq
MIRT929642	hsa-miR-451b	CLIP-seq
MIRT929643	hsa-miR-4753-3p	CLIP-seq
MIRT929644	hsa-miR-490-5p	CLIP-seq
MIRT929645	hsa-miR-548c-3p	CLIP-seq
MIRT1975238	hsa-miR-2682	CLIP-seq
MIRT1975239	hsa-miR-3167	CLIP-seq
MIRT1975240	hsa-miR-34a	CLIP-seq
MIRT1975241	hsa-miR-34c-5p	CLIP-seq
MIRT1975242	hsa-miR-3613-3p	CLIP-seq
MIRT1975243	hsa-miR-3617	CLIP-seq
MIRT1975244	hsa-miR-3714	CLIP-seq
MIRT1975245	hsa-miR-4263	CLIP-seq
MIRT1975246	hsa-miR-449a	CLIP-seq
MIRT1975247	hsa-miR-449b	CLIP-seq
MIRT1975248	hsa-miR-449c	CLIP-seq
MIRT929642	hsa-miR-451b	CLIP-seq
MIRT1975249	hsa-miR-4696	CLIP-seq
MIRT1975250	hsa-miR-548an	CLIP-seq
MIRT1975251	hsa-miR-576-5p	CLIP-seq
MIRT1975252	hsa-miR-641	CLIP-seq
MIRT1975253	hsa-miR-876-5p	CLIP-seq
MIRT2210634	hsa-miR-335	CLIP-seq
MIRT1975249	hsa-miR-4696	CLIP-seq
MIRT2210635	hsa-miR-4731-3p	CLIP-seq
MIRT2210636	hsa-miR-4801	CLIP-seq
MIRT2210637	hsa-miR-642b	CLIP-seq
MIRT2514556	hsa-miR-1202	CLIP-seq
MIRT929634	hsa-miR-1261	CLIP-seq
MIRT929635	hsa-miR-1273d	CLIP-seq
MIRT1975238	hsa-miR-2682	CLIP-seq
MIRT2210634	hsa-miR-335	CLIP-seq
MIRT1975240	hsa-miR-34a	CLIP-seq
MIRT1975241	hsa-miR-34c-5p	CLIP-seq
MIRT1975243	hsa-miR-3617	CLIP-seq
MIRT1975244	hsa-miR-3714	CLIP-seq
MIRT929640	hsa-miR-3914	CLIP-seq
MIRT2514557	hsa-miR-3972	CLIP-seq
MIRT1975246	hsa-miR-449a	CLIP-seq
MIRT1975247	hsa-miR-449b	CLIP-seq
MIRT1975248	hsa-miR-449c	CLIP-seq
MIRT2210635	hsa-miR-4731-3p	CLIP-seq
MIRT2210636	hsa-miR-4801	CLIP-seq
MIRT929644	hsa-miR-490-5p	CLIP-seq
MIRT1975250	hsa-miR-548an	CLIP-seq
MIRT929645	hsa-miR-548c-3p	CLIP-seq
MIRT1975252	hsa-miR-641	CLIP-seq
MIRT2210637	hsa-miR-642b	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003724	Function	RNA helicase activity	IEA
GO:0003724	Function	RNA helicase activity	TAS	8660968
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	30021884, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006364	Process	RRNA processing	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0097065	Process	Anterior head development	IEA

MIM	HGNC	e!Ensembl
601235	2735	ENSG00000178105

Q13206

Protein name

Probable ATP-dependent RNA helicase DDX10 (EC 3.6.4.13) (DEAD box protein 10)

Protein function

Putative ATP-dependent RNA helicase that plays various role in innate immunity or inflammation. Plays a role in the enhancement of AIM2-induced inflammasome activation by interacting with AIM2 and stabilizing its protein level (PubMed:32519665).

PDB

2PL3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00270	DEAD	93 → 263	DEAD/DEAH box helicase	Domain
PF00271	Helicase_C	299 → 410	Helicase conserved C-terminal domain	Family
PF13959	DUF4217	450 → 510	Domain of unknown function (DUF4217)	Domain

Tissue specificity

TISSUE SPECIFICITY: High in testis but widely expressed.

Sequence

MGKTANSPGSGARPDPVRSFNRWKKKHSHRQNKKKQLRKQLKKPEWQVERESISRLMQNY
EKINVNEITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKT
LAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGGKD
LKHEAERINNINILVCTPGRLLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVI
ENLPKKRQTLLFSATQTKSVKDLARLSLKNPEYVWVHEKAKYSTPATLEQNYIVCELQQK
ISVLYSFLRSHLKKKSIVFFSSCKEVQYLYRVFCRLRPGVSILALHGRQQQMRRMEVYNE
FVRKRAAVLFATDIAARGLDFPAVNWVLQFDCPEDANTYIHRAGRTARYKEDGEALLILL
PSEKAMVQQLLQKKVPVKEIKINPEKLIDVQKKLESILAQDQDLKERAQRCFVSYVRSVY
LMKDKEVFDVSKLPIPEYALSLGLAVAPRVRFLQKMQKQPTKELVRSQADKVIEPRAPSL
TNDEVEEFRAYFNEKMSILQKGGKRLEGTEHRQDNDTGNEEQEEEEDDEEEMEEKLAKAK
GSQAPSLPNTSEAQKIKEVPTQFLDRDEEEEDADFLKVKRHNVFGLDLKDEKTLQKKEPS
KSSIKKKMTKVAEAKKVMKRNFKVNKKITFTDEGELVQQWPQMQKSAIKDAEEDDDTGGI
NLHKAKERLQEEDKFDKEEYRKKIKAKHREKRLKEREARREANKRQAKAKDEEEAFLDWS
DDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDMENKISDTKKKQGMKKRSNSEVEDVGPTS
HNRKKARWDTLEPLDTGLSLAEDEELVLHLLRSQS

Sequence length

875

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DDX10-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	23496902, 30348128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23496902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	9166830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26713367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	17116492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	34797290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34797290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	10830185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10397741, 23522748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23496902, 30348128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26713367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16467868, 17116492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	10222653		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10222653, 15721630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10830185, 40269371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15721630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19536088, 26713367, 30348128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30738579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30738579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26713367		★★★★★ ★☆☆☆☆ Found in Text Mining only

DDX10 (DEAD-box helicase 10)