CHST13 (carbohydrate sulfotransferase 13)

Gene

• Entrez ID: 166012
• Gene name: Carbohydrate sulfotransferase 13
• Gene symbol: CHST13
• Synonyms (NCBI Gene): C4ST3
• Chromosome: 3
• Chromosome location: 3q21.3
• Summary: The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to the C4 hydroxyl of beta-1,4-linked N-acetylgalactosamine (GalNAc) flanked by glucuronic acid residue

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT892240	hsa-miR-3190	CLIP-seq
MIRT892241	hsa-miR-3202	CLIP-seq
MIRT892242	hsa-miR-34a	CLIP-seq
MIRT892243	hsa-miR-34c-5p	CLIP-seq
MIRT892244	hsa-miR-3714	CLIP-seq
MIRT892245	hsa-miR-449a	CLIP-seq
MIRT892246	hsa-miR-449b	CLIP-seq
MIRT892247	hsa-miR-4533	CLIP-seq
MIRT892248	hsa-miR-4660	CLIP-seq
MIRT1964413	hsa-miR-124	CLIP-seq
MIRT1964414	hsa-miR-506	CLIP-seq
MIRT1964415	hsa-miR-548an	CLIP-seq
MIRT2503338	hsa-miR-1267	CLIP-seq
MIRT2503339	hsa-miR-25	CLIP-seq
MIRT2503340	hsa-miR-32	CLIP-seq
MIRT2503341	hsa-miR-363	CLIP-seq
MIRT2503342	hsa-miR-367	CLIP-seq
MIRT2503343	hsa-miR-4283	CLIP-seq
MIRT2503344	hsa-miR-4733-3p	CLIP-seq
MIRT2503345	hsa-miR-760	CLIP-seq
MIRT2503346	hsa-miR-767-5p	CLIP-seq
MIRT2503347	hsa-miR-92a	CLIP-seq
MIRT2503348	hsa-miR-92b	CLIP-seq
MIRT2678165	hsa-miR-1207-5p	CLIP-seq
MIRT2503338	hsa-miR-1267	CLIP-seq
MIRT2503339	hsa-miR-25	CLIP-seq
MIRT2503340	hsa-miR-32	CLIP-seq
MIRT2503341	hsa-miR-363	CLIP-seq
MIRT2503342	hsa-miR-367	CLIP-seq
MIRT2503343	hsa-miR-4283	CLIP-seq
MIRT2678166	hsa-miR-4446-3p	CLIP-seq
MIRT2678167	hsa-miR-4656	CLIP-seq
MIRT2678168	hsa-miR-4688	CLIP-seq
MIRT2678169	hsa-miR-4698	CLIP-seq
MIRT2503344	hsa-miR-4733-3p	CLIP-seq
MIRT2678170	hsa-miR-4763-3p	CLIP-seq
MIRT2678171	hsa-miR-486-3p	CLIP-seq
MIRT2503345	hsa-miR-760	CLIP-seq
MIRT2503346	hsa-miR-767-5p	CLIP-seq
MIRT2503347	hsa-miR-92a	CLIP-seq
MIRT2503348	hsa-miR-92b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001537	Function	Dermatan 4-sulfotransferase activity	IDA	12080076
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005794	Component	Golgi apparatus	IEA
GO:0008146	Function	Sulfotransferase activity	IBA
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	12080076
GO:0016051	Process	Carbohydrate biosynthetic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030166	Process	Proteoglycan biosynthetic process	IBA
GO:0047756	Function	Chondroitin 4-sulfotransferase activity	IDA	12080076
GO:0047756	Function	Chondroitin 4-sulfotransferase activity	IEA
GO:0047756	Function	Chondroitin 4-sulfotransferase activity	TAS
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	IDA	12080076
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	TAS

Other IDs

• MIM: 610124
• HGNC: 21755
• e!Ensembl: ENSG00000180767

Protein

• UniProt ID: Q8NET6
• Protein name: Carbohydrate sulfotransferase 13 (EC 2.8.2.5) (Chondroitin 4-O-sulfotransferase 3) (Chondroitin 4-sulfotransferase 3) (C4ST-3) (C4ST3)
• Protein function: Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03567	Sulfotransfer_2	97 → 333	Sulfotransferase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in adult liver. Expressed at lower level in kidney, lymph nodes and fetal kidney. {ECO:0000269|PubMed:12080076}.
• Sequence:

  MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQ
  DPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNW
  KRVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERL
  ASAYRNKLARPYSAAFQRRYGARIVQRLRPRALPDARARGHDVRFAEFLAYLLDPRTRRE
  EPFNEHWERAHALCHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAAS
  RDLAARLFRDISPFYQRRLFDLYKMDFLLFNYSAPSYLRLL

• Sequence length: 341

Pathways

KEGG:

Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate

Reactome:

Chondroitin sulfate biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36618366	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28274888		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30118797		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	28274888, 30661165, 31845005		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28274888, 29514696	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26084610	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30118797		★☆☆☆☆ Found in Text Mining only