DHX9 (DExH-box helicase 9)

Gene

• Entrez ID: 1660
• Gene name: DExH-box helicase 9
• Gene symbol: DHX9
• Synonyms (NCBI Gene): DDX9, LKP, MRD75, NDH2, NDHII, RHA
• Chromosome: 1
• Chromosome location: 1q25.3
• Summary: This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytopla

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052611	hsa-let-7a-5p	CLASH	23622248
MIRT052356	hsa-let-7b-5p	CLASH	23622248
MIRT051876	hsa-let-7c-5p	CLASH	23622248
MIRT050296	hsa-miR-25-3p	CLASH	23622248
MIRT045580	hsa-miR-149-5p	CLASH	23622248
MIRT041017	hsa-miR-505-3p	CLASH	23622248
MIRT038769	hsa-miR-93-3p	CLASH	23622248
MIRT935771	hsa-miR-1262	CLIP-seq
MIRT935772	hsa-miR-140-3p	CLIP-seq
MIRT935773	hsa-miR-329	CLIP-seq
MIRT935774	hsa-miR-34b	CLIP-seq
MIRT935775	hsa-miR-34c-3p	CLIP-seq
MIRT935776	hsa-miR-3618	CLIP-seq
MIRT935777	hsa-miR-362-3p	CLIP-seq
MIRT935778	hsa-miR-3647-3p	CLIP-seq
MIRT935779	hsa-miR-3682-5p	CLIP-seq
MIRT935780	hsa-miR-3688-5p	CLIP-seq
MIRT935781	hsa-miR-3941	CLIP-seq
MIRT935782	hsa-miR-4470	CLIP-seq
MIRT935783	hsa-miR-4506	CLIP-seq
MIRT935784	hsa-miR-4693-5p	CLIP-seq
MIRT935785	hsa-miR-4699-3p	CLIP-seq
MIRT935786	hsa-miR-4701-3p	CLIP-seq
MIRT935787	hsa-miR-4789-3p	CLIP-seq
MIRT935788	hsa-miR-532-5p	CLIP-seq
MIRT935789	hsa-miR-548ag	CLIP-seq
MIRT935790	hsa-miR-548ai	CLIP-seq
MIRT935791	hsa-miR-548m	CLIP-seq
MIRT935792	hsa-miR-586	CLIP-seq
MIRT935793	hsa-miR-603	CLIP-seq
MIRT935794	hsa-miR-873	CLIP-seq
MIRT935795	hsa-miR-934	CLIP-seq
MIRT1976986	hsa-miR-299-3p	CLIP-seq
MIRT935773	hsa-miR-329	CLIP-seq
MIRT935774	hsa-miR-34b	CLIP-seq
MIRT935775	hsa-miR-34c-3p	CLIP-seq
MIRT935776	hsa-miR-3618	CLIP-seq
MIRT935777	hsa-miR-362-3p	CLIP-seq
MIRT935781	hsa-miR-3941	CLIP-seq
MIRT1976987	hsa-miR-4491	CLIP-seq
MIRT1976988	hsa-miR-4657	CLIP-seq
MIRT935784	hsa-miR-4693-5p	CLIP-seq
MIRT935788	hsa-miR-532-5p	CLIP-seq
MIRT935793	hsa-miR-603	CLIP-seq
MIRT935795	hsa-miR-934	CLIP-seq
MIRT935771	hsa-miR-1262	CLIP-seq
MIRT935772	hsa-miR-140-3p	CLIP-seq
MIRT2212421	hsa-miR-200b	CLIP-seq
MIRT2212422	hsa-miR-200c	CLIP-seq
MIRT2212423	hsa-miR-2054	CLIP-seq
MIRT935778	hsa-miR-3647-3p	CLIP-seq
MIRT2212424	hsa-miR-429	CLIP-seq
MIRT935783	hsa-miR-4506	CLIP-seq
MIRT935786	hsa-miR-4701-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SOX4	Unknown	19147588;22098624

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000380	Process	Alternative mRNA splicing, via spliceosome	IMP	28221134
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	11038348
GO:0000993	Function	RNA polymerase II complex binding	IDA	11416126
GO:0001069	Function	Regulatory region RNA binding	IDA	28355180
GO:0001069	Function	Regulatory region RNA binding	IEA
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0002376	Process	Immune system process	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003678	Function	DNA helicase activity	IMP	12711669
GO:0003678	Function	DNA helicase activity	TAS	9111062
GO:0003688	Function	DNA replication origin binding	IDA	24990949
GO:0003690	Function	Double-stranded DNA binding	IDA	9111062, 12711669
GO:0003697	Function	Single-stranded DNA binding	IDA	9111062, 10198287, 20696886, 21957149
GO:0003712	Function	Transcription coregulator activity	IMP	11416126
GO:0003713	Function	Transcription coactivator activity	IMP	9323138
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	1537828
GO:0003723	Function	RNA binding	IEA
GO:0003724	Function	RNA helicase activity	IBA
GO:0003724	Function	RNA helicase activity	IDA	28221134
GO:0003724	Function	RNA helicase activity	IEA
GO:0003724	Function	RNA helicase activity	ISS
GO:0003724	Function	RNA helicase activity	TAS	8690889, 9111062
GO:0003725	Function	Double-stranded RNA binding	IDA	9111062, 10198287, 12711669, 21957149, 27107641, 28636595
GO:0003725	Function	Double-stranded RNA binding	IEA
GO:0003727	Function	Single-stranded RNA binding	IDA	9111062, 10198287
GO:0003729	Function	MRNA binding	IDA	10198287
GO:0003729	Function	MRNA binding	IMP	28221134
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	9323138, 9662397, 10924507, 11402034, 11687588, 12711669, 14704337, 15084609, 15355351, 17289661, 17498979, 17531811, 18519039, 18596238, 19955415, 20123736, 20696886, 21247876, 21849455, 21903422, 22190748, 23361462, 23652018, 23986595, 24965446, 28221134, 28355180, 28636595, 29395
GO:0005524	Function	ATP binding	IDA	11416126
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	9162007, 10198287, 10207077, 11687588, 15121898, 16375861, 16680162, 17498979, 24965446, 37467750
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9111062
GO:0005654	Component	Nucleoplasm	IDA	28221134
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005726	Component	Perichromatin fibrils	IDA	10198287
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	9162007, 10198287, 10207077, 16375861, 16680162, 20696886, 21247876, 22190748
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8690889
GO:0005813	Component	Centrosome	IDA	17498979
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA	19029303
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006325	Process	Chromatin organization	IMP	12711669
GO:0006353	Process	DNA-templated transcription termination	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	9662397
GO:0006397	Process	MRNA processing	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0015629	Component	Actin cytoskeleton	IDA	11687588
GO:0016020	Component	Membrane	HDA	16210410, 19946888
GO:0016442	Component	RISC complex	IDA	17531811
GO:0016604	Component	Nuclear body	IDA	28221134
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IMP	11416126, 37467750
GO:0017111	Function	Ribonucleoside triphosphate phosphatase activity	ISS
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031490	Function	Chromatin DNA binding	IDA	24049074
GO:0032727	Process	Positive regulation of interferon-alpha production	IMP	21957149
GO:0032728	Process	Positive regulation of interferon-beta production	IMP	21957149
GO:0032741	Process	Positive regulation of interleukin-18 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	20696886, 21957149
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	20696886, 21957149
GO:0032991	Component	Protein-containing complex	IDA	11687588
GO:0033679	Function	3'-5' DNA/RNA helicase activity	IDA	1537828, 21561811
GO:0033679	Function	3'-5' DNA/RNA helicase activity	IEA
GO:0034458	Function	3'-5' RNA helicase activity	IDA	1537828, 21561811
GO:0035195	Process	MiRNA-mediated post-transcriptional gene silencing	IMP	17531811
GO:0035197	Function	SiRNA binding	IDA	23361462
GO:0035613	Function	RNA stem-loop binding	IDA	11096080, 16680162
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	10198287, 15121898
GO:0039695	Process	DNA-templated viral transcription	IDA	11096080
GO:0043022	Function	Ribosome binding	IDA	16680162, 21247876
GO:0043138	Function	3'-5' DNA helicase activity	IBA
GO:0043138	Function	3'-5' DNA helicase activity	IDA	21561811
GO:0043138	Function	3'-5' DNA helicase activity	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	ISS
GO:0045142	Function	Triplex DNA binding	IDA	24049074
GO:0045739	Process	Positive regulation of DNA repair	IMP	24049074
GO:0045740	Process	Positive regulation of DNA replication	IMP	24990949
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	9323138, 11038348, 11416126, 21957149
GO:0046833	Process	Positive regulation of RNA export from nucleus	IDA	11402034
GO:0046872	Function	Metal ion binding	IEA
GO:0047429	Function	Nucleoside triphosphate diphosphatase activity	IDA	1537828
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	24990949
GO:0048511	Process	Rhythmic process	IEA
GO:0050434	Process	Positive regulation of viral transcription	IDA	11096080
GO:0050684	Process	Regulation of mRNA processing	IBA
GO:0050684	Process	Regulation of mRNA processing	IDA	28355180
GO:0050691	Process	Regulation of defense response to virus by host	ISS
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0051028	Process	MRNA transport	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	15355351
GO:0060760	Process	Positive regulation of response to cytokine stimulus	IMP	21957149
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	17303075
GO:0061676	Function	Importin-alpha family protein binding	IDA	16375861
GO:0065003	Process	Protein-containing complex assembly	IDA	23361462
GO:0070063	Function	RNA polymerase binding	IDA	9323138
GO:0070063	Function	RNA polymerase binding	IEA
GO:0070269	Process	Pyroptotic inflammatory response	ISS
GO:0070578	Component	RISC-loading complex	IMP	17531811
GO:0070922	Process	RISC complex assembly	IMP	17531811
GO:0070934	Process	CRD-mediated mRNA stabilization	IDA	19029303
GO:0070934	Process	CRD-mediated mRNA stabilization	IMP	19029303
GO:0070937	Component	CRD-mediated mRNA stability complex	IDA	19029303
GO:0070937	Component	CRD-mediated mRNA stability complex	IPI	19029303
GO:0071360	Process	Cellular response to exogenous dsRNA	IMP	21957149
GO:0097165	Component	Nuclear stress granule	IDA	10198287
GO:0097165	Component	Nuclear stress granule	IMP	24965446
GO:0140640	Function	Catalytic activity, acting on a nucleic acid	IDA	21561811
GO:1900152	Process	Negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	19029303
GO:1903608	Process	Protein localization to cytoplasmic stress granule	IMP	24965446
GO:1905172	Function	RISC complex binding	IDA	17531811
GO:1990518	Function	Single-stranded 3'-5' DNA helicase activity	IDA	20669935, 24049074
GO:1990825	Function	Sequence-specific mRNA binding	IDA	9162007, 11402034
GO:1990841	Function	Promoter-specific chromatin binding	IMP	28221134
GO:1990904	Component	Ribonucleoprotein complex	IBA
GO:1990904	Component	Ribonucleoprotein complex	IDA	11402034, 12711669, 14704337, 17289661, 18809582
GO:1990904	Component	Ribonucleoprotein complex	IMP	28221134
GO:2000765	Process	Regulation of cytoplasmic translation	IDA	28355180
GO:2000767	Process	Positive regulation of cytoplasmic translation	IDA	19029303
GO:2000767	Process	Positive regulation of cytoplasmic translation	IMP	16680162, 21247876, 22190748

Other IDs

• MIM: 603115
• HGNC: 2750
• e!Ensembl: ENSG00000135829

Protein

• UniProt ID: Q08211
• Protein name: ATP-dependent RNA helicase A (EC 3.6.4.13) (DEAH box protein 9) (DExH-box helicase 9) (Leukophysin) (LKP) (Nuclear DNA helicase II) (NDH II) (RNA helicase A)
• Protein function: Multifunctional ATP-dependent nucleic acid helicase that unwinds DNA and RNA in a 3' to 5' direction and that plays important roles in many processes, such as DNA replication, transcriptional activation, post-transcriptional RNA regulation, mRNA
• PDB: 3LLM, 3VYX, 3VYY, 8SZP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00035	dsrm	4 → 69	Double-stranded RNA binding motif	Domain
  PF00035	dsrm	181 → 250	Double-stranded RNA binding motif	Domain
  PF00270	DEAD	391 → 551	DEAD/DEAH box helicase	Domain
  PF00271	Helicase_C	635 → 769	Helicase conserved C-terminal domain	Family
  PF04408	HA2	832 → 929	Helicase associated domain (HA2)	Domain
  PF07717	OB_NTP_bind	991 → 1074	Oligonucleotide/oligosaccharide-binding (OB)-fold	Domain

• Sequence:

  MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSN
  AARDFVNYLVRINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALK
  AENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLEN
  AKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQ
  SCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPP
  PEDPSVPVALNIGKLAQFEPSQRQNQVGVVPWSPPQSNWNPWTSSNIDEGPLAFATPEQI
  SMDLKNELMYQLEQDHDLQAILQERELLPVKKFESEILEAISQNSVVIIRGATGCGKTTQ
  VPQFILDDFIQNDRAAECNIVVTQPRRISAVSVAERVAFERGEEPGKSCGYSVRFESILP
  RPHASIMFCTVGVLLRKLEAGIRGISHVIVDEIHERDINTDFLLVVLRDVVQAYPEVRIV
  LMSATIDTSMFCEYFFNCPIIEVYGRTYPVQEYFLEDCIQMTHFVPPPKDKKKKDKDDDG
  GEDDDANCNLICGDEYGPETRLSMSQLNEKETPFELIEALLKYIETLNVPGAVLVFLPGW
  NLIYTMQKHLEMNPHFGSHRYQILPLHSQIPREEQRKVFDPVPVGVTKVILSTNIAETSI
  TINDVVYVIDSCKQKVKLFTAHNNMTNYATVWASKTNLEQRKGRAGRVRPGFCFHLCSRA
  RFERLETHMTPEMFRTPLHEIALSIKLLRLGGIGQFLAKAIEPPPLDAVIEAEHTLRELD
  ALDANDELTPLGRILAKLPIEPRFGKMMIMGCIFYVGDAICTIAAATCFPEPFINEGKRL
  GYIHRNFAGNRFSDHVALLSVFQAWDDARMGGEEAEIRFCEHKRLNMATLRMTWEAKVQL
  KEILINSGFPEDCLLTQVFTNTGPDNNLDVVISLLAFGVYPNVCYHKEKRKILTTEGRNA
  LIHKSSVNCPFSSQDMKYPSPFFVFGEKIRTRAISAKGMTLVTPLQLLLFASKKVQSDGQ
  IVLVDDWIKLQISHEAAACITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISR
  PSAAGINLMIGSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYSSGGYGSGGYG
  GSANSFRAGYGAGVGGGYRGVSRGGFRGNSGGDYRGPSGGYRGSGGFQRGGGRGAYGTGY
  FGQGRGGGGY

• Sequence length: 1270

Pathways

Reactome:

RIP-mediated NFkB activation via ZBP1
DEx/H-box helicases activate type I IFN and inflammatory cytokines production
mRNA Splicing - Major Pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Charcot-Marie-Tooth disease	Likely pathogenic	rs2526370283	RCV003444183	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
DHX9-related disorder	Likely pathogenic; Pathogenic	rs2526377906	RCV003238926	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
DHX9-related neurodevelopmental disorder	Likely pathogenic	rs2526439955	RCV003389296	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual developmental disorder, autosomal dominant 75	Likely pathogenic; Pathogenic	rs2526377906	RCV004775366	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31497206		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31360192		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	17265494	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19197335, 28176758		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20802156, 26273641, 37550275, 37890687	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34676915, 36071875	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	14654934, 28337295		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36367018	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30518908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	30518908		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28224203		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28224203		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28192486		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	17265494		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34182081	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34182081	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29687002	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	40018947	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17265494, 20537203, 29070082	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17265494		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23440244, 26973242, 28427210		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	32209064	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19197335, 28176758		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31815296		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	14654934, 28337295		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26885691, 26973242, 28337295, 29796672, 31072811		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30518908		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28176758		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	31665043		★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	BEFREE	23853588		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24469107, 26885691, 26973242, 28460433, 29796672, 30803049		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24469107		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30341290	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28337295		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28460433		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	38241710	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35590370	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	26450900, 32023846	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31228641, 31306676		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29070082	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28337295		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	15995249		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	LHGDN	15995249		★☆☆☆☆ Found in Text Mining only