Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1649
Gene name	DNA damage inducible transcript 3
Gene symbol	DDIT3
Synonyms (NCBI Gene)	AltDDIT3C/EBPzetaCEBPZCHOPCHOP-10CHOP10GADD153
Chromosome	12
Chromosome location	12q13.3
Summary	This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator prote

163

Show/Hide all (163)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016927	hsa-miR-335-5p	Microarray	18185580
MIRT023280	hsa-miR-122-5p	Other	21750653
MIRT027903	hsa-miR-96-5p	Sequencing	20371350
MIRT054455	hsa-miR-211-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	24039954
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	20371350
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	20371350
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	20371350
MIRT512375	hsa-miR-633	PAR-CLIP	20371350
MIRT525507	hsa-miR-5692a	PAR-CLIP	22012620
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	22012620
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	22012620
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	22012620
MIRT512375	hsa-miR-633	PAR-CLIP	22012620
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	23446348
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	23446348
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	23446348
MIRT512375	hsa-miR-633	PAR-CLIP	23446348
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	26701625
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	26701625
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	26701625
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	26701625
MIRT512375	hsa-miR-633	PAR-CLIP	26701625
MIRT512375	hsa-miR-633	PAR-CLIP	26701625
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	26701625
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	27292025
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	27292025
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	27292025
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	27292025
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	27292025
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	27292025
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	27292025
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	27292025
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	27292025
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	27292025
MIRT512375	hsa-miR-633	PAR-CLIP	27292025
MIRT512375	hsa-miR-633	PAR-CLIP	27292025
MIRT512375	hsa-miR-633	PAR-CLIP	27292025
MIRT512375	hsa-miR-633	PAR-CLIP	27292025
MIRT512375	hsa-miR-633	PAR-CLIP	27292025
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	27292025
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	27292025
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	27292025
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	27292025
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	27292025
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	20371350
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	20371350
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	20371350
MIRT512375	hsa-miR-633	PAR-CLIP	20371350
MIRT525507	hsa-miR-5692a	PAR-CLIP	22012620
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	22012620
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	22012620
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	22012620
MIRT512375	hsa-miR-633	PAR-CLIP	22012620
MIRT512378	hsa-miR-7845-5p	PAR-CLIP	23446348
MIRT512377	hsa-miR-135a-3p	PAR-CLIP	23446348
MIRT512376	hsa-miR-4645-3p	PAR-CLIP	23446348
MIRT512375	hsa-miR-633	PAR-CLIP	23446348
MIRT929252	hsa-miR-216b	CLIP-seq
MIRT929253	hsa-miR-224	CLIP-seq
MIRT929254	hsa-miR-3675-3p	CLIP-seq
MIRT929255	hsa-miR-376a	CLIP-seq
MIRT929256	hsa-miR-376b	CLIP-seq
MIRT1975173	hsa-miR-199a-3p	CLIP-seq
MIRT1975174	hsa-miR-199b-3p	CLIP-seq
MIRT1975175	hsa-miR-3129-5p	CLIP-seq
MIRT1975176	hsa-miR-936	CLIP-seq
MIRT2210530	hsa-miR-1271	CLIP-seq
MIRT2210531	hsa-miR-1275	CLIP-seq
MIRT2210532	hsa-miR-142-3p	CLIP-seq
MIRT2210533	hsa-miR-299-3p	CLIP-seq
MIRT2210534	hsa-miR-3132	CLIP-seq
MIRT2210535	hsa-miR-3136-3p	CLIP-seq
MIRT2210536	hsa-miR-3153	CLIP-seq
MIRT2210537	hsa-miR-3174	CLIP-seq
MIRT2210538	hsa-miR-3192	CLIP-seq
MIRT2210539	hsa-miR-3199	CLIP-seq
MIRT2210540	hsa-miR-4314	CLIP-seq
MIRT2210541	hsa-miR-4447	CLIP-seq
MIRT2210542	hsa-miR-4472	CLIP-seq
MIRT2210543	hsa-miR-4491	CLIP-seq
MIRT2210544	hsa-miR-4525	CLIP-seq
MIRT2210545	hsa-miR-4646-5p	CLIP-seq
MIRT2210546	hsa-miR-4648	CLIP-seq
MIRT2210547	hsa-miR-4652-5p	CLIP-seq
MIRT2210548	hsa-miR-4654	CLIP-seq
MIRT2210549	hsa-miR-4657	CLIP-seq
MIRT2210550	hsa-miR-4665-5p	CLIP-seq
MIRT2210551	hsa-miR-4668-5p	CLIP-seq
MIRT2210552	hsa-miR-4723-5p	CLIP-seq
MIRT2210553	hsa-miR-4740-5p	CLIP-seq
MIRT2210554	hsa-miR-4769-5p	CLIP-seq
MIRT2210555	hsa-miR-625	CLIP-seq
MIRT2210556	hsa-miR-644	CLIP-seq
MIRT2210557	hsa-miR-648	CLIP-seq
MIRT2210558	hsa-miR-663b	CLIP-seq
MIRT2210559	hsa-miR-921	CLIP-seq
MIRT2210560	hsa-miR-96	CLIP-seq
MIRT2210530	hsa-miR-1271	CLIP-seq
MIRT2210532	hsa-miR-142-3p	CLIP-seq
MIRT1975173	hsa-miR-199a-3p	CLIP-seq
MIRT1975174	hsa-miR-199b-3p	CLIP-seq
MIRT2210533	hsa-miR-299-3p	CLIP-seq
MIRT2514511	hsa-miR-3124-3p	CLIP-seq
MIRT1975175	hsa-miR-3129-5p	CLIP-seq
MIRT2210534	hsa-miR-3132	CLIP-seq
MIRT2210535	hsa-miR-3136-3p	CLIP-seq
MIRT2514512	hsa-miR-3145-5p	CLIP-seq
MIRT2210536	hsa-miR-3153	CLIP-seq
MIRT2210537	hsa-miR-3174	CLIP-seq
MIRT2210538	hsa-miR-3192	CLIP-seq
MIRT2514513	hsa-miR-3193	CLIP-seq
MIRT2514514	hsa-miR-3614-3p	CLIP-seq
MIRT2514515	hsa-miR-3618	CLIP-seq
MIRT2514516	hsa-miR-3679-3p	CLIP-seq
MIRT2514517	hsa-miR-4297	CLIP-seq
MIRT2210540	hsa-miR-4314	CLIP-seq
MIRT2210543	hsa-miR-4491	CLIP-seq
MIRT2210545	hsa-miR-4646-5p	CLIP-seq
MIRT2210546	hsa-miR-4648	CLIP-seq
MIRT2210548	hsa-miR-4654	CLIP-seq
MIRT2210549	hsa-miR-4657	CLIP-seq
MIRT2210551	hsa-miR-4668-5p	CLIP-seq
MIRT2210554	hsa-miR-4769-5p	CLIP-seq
MIRT2514518	hsa-miR-4786-5p	CLIP-seq
MIRT2514519	hsa-miR-508-5p	CLIP-seq
MIRT2210556	hsa-miR-644	CLIP-seq
MIRT2210557	hsa-miR-648	CLIP-seq
MIRT2210558	hsa-miR-663b	CLIP-seq
MIRT2514520	hsa-miR-769-5p	CLIP-seq
MIRT2210559	hsa-miR-921	CLIP-seq
MIRT2514521	hsa-miR-934	CLIP-seq
MIRT1975176	hsa-miR-936	CLIP-seq
MIRT2210560	hsa-miR-96	CLIP-seq
MIRT1975173	hsa-miR-199a-3p	CLIP-seq
MIRT1975174	hsa-miR-199b-3p	CLIP-seq
MIRT2210533	hsa-miR-299-3p	CLIP-seq
MIRT2514511	hsa-miR-3124-3p	CLIP-seq
MIRT1975175	hsa-miR-3129-5p	CLIP-seq
MIRT2210534	hsa-miR-3132	CLIP-seq
MIRT2514512	hsa-miR-3145-5p	CLIP-seq
MIRT2210536	hsa-miR-3153	CLIP-seq
MIRT2210537	hsa-miR-3174	CLIP-seq
MIRT2210538	hsa-miR-3192	CLIP-seq
MIRT2514513	hsa-miR-3193	CLIP-seq
MIRT2514514	hsa-miR-3614-3p	CLIP-seq
MIRT2514515	hsa-miR-3618	CLIP-seq
MIRT2514516	hsa-miR-3679-3p	CLIP-seq
MIRT2514517	hsa-miR-4297	CLIP-seq
MIRT2210540	hsa-miR-4314	CLIP-seq
MIRT2210543	hsa-miR-4491	CLIP-seq
MIRT2210545	hsa-miR-4646-5p	CLIP-seq
MIRT2210546	hsa-miR-4648	CLIP-seq
MIRT2210548	hsa-miR-4654	CLIP-seq
MIRT2210549	hsa-miR-4657	CLIP-seq
MIRT2210551	hsa-miR-4668-5p	CLIP-seq
MIRT2210554	hsa-miR-4769-5p	CLIP-seq
MIRT2514518	hsa-miR-4786-5p	CLIP-seq
MIRT2514519	hsa-miR-508-5p	CLIP-seq
MIRT2514520	hsa-miR-769-5p	CLIP-seq
MIRT2210559	hsa-miR-921	CLIP-seq
MIRT2514521	hsa-miR-934	CLIP-seq
MIRT1975176	hsa-miR-936	CLIP-seq

Show/Hide all (17)

Transcription factor	Regulation	Reference
ATF3	Activation	22753726
ATF4	Activation	16246168;17276738;20020050;21044953;21966512
ATF4	Unknown	17455323;22691366
ATF6	Unknown	17455323
BRCA1	Activation	21700680
CEBPB	Unknown	16757577
CEBPD	Activation	20971808
CEBPD	Repression	22347430
E2F1	Unknown	20971808
FOS	Activation	20188076
FUS	Activation	11162437
JDP2	Repression	18396163
JUN	Activation	22622069
NFYA	Unknown	20023394
RB1	Unknown	20971808
STAT3	Repression	23288901
XBP1	Unknown	17455323

144

Show/Hide all (144)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	24038088
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16434966, 18940792
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IGI	11478948
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISO
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IC	15322075
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	24939851
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	22065586
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	22065586
GO:0001955	Process	Blood vessel maturation	IEA
GO:0002086	Process	Diaphragm contraction	IEA
GO:0003677	Function	DNA binding	IDA	14667815, 18940792
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	15322075, 30639358
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IGI	24939851
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0003700	Function	DNA-binding transcription factor activity	NAS	8510758
GO:0003714	Function	Transcription corepressor activity	IDA	24038088
GO:0003714	Function	Transcription corepressor activity	IGI	11478948
GO:0005515	Function	Protein binding	IPI	15775988, 16189514, 17872950, 18330356, 18940792, 20102225, 20211142, 20562859, 20829347, 21988832, 22761832, 23661758, 25416956, 27107012, 29083303, 29997244, 31467278, 32296183, 32814053, 32911434, 33961781, 34799561, 37398436
GO:0005634	Component	Nucleus	IDA	11478948, 15322075, 20829347, 22761832, 29083303, 33384352
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8622660, 8657121, 20102225, 23661758
GO:0005667	Component	Transcription regulator complex	NAS	15775988
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	29083303
GO:0005737	Component	Cytoplasm	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005829	Component	Cytosol	TAS	14685163
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	17872950, 22761832
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	14667815
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	8622660
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	TAS	1339368
GO:0006983	Process	ER overload response	IBA
GO:0006983	Process	ER overload response	IEA
GO:0006986	Process	Response to unfolded protein	IDA	18940792
GO:0006986	Process	Response to unfolded protein	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0008140	Function	CAMP response element binding protein binding	IEA
GO:0008140	Function	CAMP response element binding protein binding	IPI	11478948
GO:0008140	Function	CAMP response element binding protein binding	ISS
GO:0009611	Process	Response to wounding	IEA
GO:0009948	Process	Anterior/posterior axis specification	IEA
GO:0009948	Process	Anterior/posterior axis specification	ISS	16434966
GO:0010467	Process	Gene expression	IEA
GO:0010506	Process	Regulation of autophagy	ISS
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	ISS
GO:0032689	Process	Negative regulation of type II interferon production	IMP	24038088
GO:0032700	Process	Negative regulation of interleukin-17 production	IMP	24038088
GO:0032713	Process	Negative regulation of interleukin-4 production	IMP	24038088
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	20829347
GO:0032993	Component	Protein-DNA complex	IDA	15322075
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	18940792, 19061639, 20829347, 24939851, 33384352
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IGI	15775988
GO:0036119	Process	Response to platelet-derived growth factor	IEA
GO:0036488	Component	CHOP-C/EBP complex	IBA
GO:0036488	Component	CHOP-C/EBP complex	IEA
GO:0036488	Component	CHOP-C/EBP complex	IPI	20102225
GO:0036488	Component	CHOP-C/EBP complex	ISS
GO:0036488	Component	CHOP-C/EBP complex	TAS	14685163
GO:0036499	Process	PERK-mediated unfolded protein response	TAS	14685163, 22934019
GO:0036500	Process	ATF6-mediated unfolded protein response	TAS	22934019
GO:0042594	Process	Response to starvation	IEA
GO:0042802	Function	Identical protein binding	IPI	20562859, 23661758
GO:0042803	Function	Protein homodimerization activity	IDA	18534616
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	17872950
GO:0043522	Function	Leucine zipper domain binding	IDA	8622660, 11478948
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IMP	22761832
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0045454	Process	Cell redox homeostasis	IDA	14667815
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	18940792
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15322075, 15775988
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15322075, 22065586, 24939851
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	15775988
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	22065586, 22761832
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046982	Function	Protein heterodimerization activity	IBA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	8622660
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	18534616
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	22761832
GO:0060840	Process	Artery development	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	16434966
GO:0061771	Process	Response to caloric restriction	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IBA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IDA	18940792, 20829347
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	15322075
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	14685163, 22934019
GO:0070509	Process	Calcium ion import	IEA
GO:0072655	Process	Establishment of protein localization to mitochondrion	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	ISS	16434966
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	26370079
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	ISS
GO:0140467	Process	Integrated stress response signaling	IDA	30639358
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:0140468	Process	HRI-mediated signaling	IDA	32132706, 32132707
GO:0140537	Function	Transcription regulator activator activity	IEA
GO:0140537	Function	Transcription regulator activator activity	ISS
GO:0160144	Process	GDF15-GFRAL signaling pathway	IDA	31535977
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IMP	22761832
GO:1904738	Process	Vascular associated smooth muscle cell migration	IEA
GO:1990442	Process	Intrinsic apoptotic signaling pathway in response to nitrosative stress	IEA
GO:1990617	Component	CHOP-ATF4 complex	IBA
GO:1990617	Component	CHOP-ATF4 complex	IDA	11478948
GO:1990617	Component	CHOP-ATF4 complex	IPI	18940792
GO:1990622	Component	CHOP-ATF3 complex	IBA
GO:1990622	Component	CHOP-ATF3 complex	IDA	8622660
GO:1990874	Process	Vascular associated smooth muscle cell proliferation	IEA
GO:2000016	Process	Negative regulation of determination of dorsal identity	IDA	16434966
GO:2000016	Process	Negative regulation of determination of dorsal identity	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	27031958

MIM	HGNC	e!Ensembl
126337	2726	ENSG00000175197

P0DPQ6

Protein name

DDIT3 upstream open reading frame protein (Alternative DDIT3 protein) (AltDDIT3)

Protein function

[Isoform AltDDIT3]: Product of the upstream open reading frame (uORF) of DDIT3/CHOP that is specifically produced in absence of stress, thereby preventing translation of downstream stress effector DDIT3/CHOP.

Family and domains

Sequence

MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT

Sequence length

P35638

Protein name

DNA damage-inducible transcript 3 protein (DDIT-3) (C/EBP zeta) (C/EBP-homologous protein) (CHOP) (C/EBP-homologous protein 10) (CHOP-10) (CCAAT/enhancer-binding protein homologous protein) (Growth arrest and DNA damage-inducible protein GADD153)

Protein function

Multifunctional transcription factor in endoplasmic reticulum (ER) stress response (PubMed:15322075, PubMed:15775988, PubMed:19672300). Plays an essential role in the response to a wide variety of cell stresses and induces cell cycle arrest and

Family and domains

Sequence

MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASL
AWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRM
KEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA

Sequence length

169

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Protein processing in endoplasmic reticulum Apoptosis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Prion disease Pathways of neurodegeneration - multiple diseases Transcriptional misregulation in cancer Lipid and atherosclerosis		FOXO-mediated transcription of cell death genes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASBESTOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 1	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOSARCOMA, MYXOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (290)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	30320353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	26469962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	28666219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	17577773, 20813005, 21883784, 22929980, 23515929, 25195038, 28357915, 28553616, 29473332, 30282447, 31485671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	21128778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	31099033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17712163	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34153352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amelogenesis imperfecta nephrocalcinosis	Amelogenesis Imperfecta	BEFREE	24178758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	23951005, 28304295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	19733664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30126466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	36494342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	31239294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30864718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	28891115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30041247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20122151, 36243930, 36675245, 37862122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	CTD_human_DG	25324550		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	28238747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24205197, 28081747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30041247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	21364653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	29761862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29973929		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25823784, 27534371, 28641223, 28860710, 29600563, 30426803, 30930218, 31077207, 31180523, 31606909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	12930346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	29843019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10534579, 22960596, 22982536, 29103159, 29291017, 29649984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	14604972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11297545, 21741997, 22200786, 28459209, 35662627, 37685841	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG	23499715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	23470621, 29901175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	20723265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	31537387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19276161, 30201954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12138118, 23658755, 23973991, 24525736, 25032846, 26917416, 27821810, 29921924, 32332695, 34123711, 35389768, 36925047, 37326827, 39273406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16463383, 21504179, 28103535, 28332554, 29702190, 30709582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34839022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25199538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28453460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Familial Hypertrophic 1	Cardiomyopathy	Pubtator	27432584	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36012132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carnevale syndrome	Carnevale syndrome	Pubtator	7592643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	35856366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	21128778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	26247732, 30209133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	18635891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	7687873		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28378140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35185383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18534616, 18852146, 20837473, 30529689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15271854, 18534616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25269802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18534616, 22922338, 30359552, 30426213, 33004975, 34088951, 36585626, 36941538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	29473332, 7687873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	24373961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	35619068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	39881366	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31557250	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	17709599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	17709599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30550797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29574669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	24703171	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	14610263, 26900721, 27157393, 29725368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	14610263, 22265908, 26900721, 27157393, 28513228, 29725368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	18680108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22403299, 34140543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22699564	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19558691, 25511473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34414940	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	23499715		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG	23499715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17620318, 17906960, 18680108, 24239558, 26900721, 30902789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG	23499715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG	23499715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34414940, 37038746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30671964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	17577773, 20813005, 21883784, 22929980, 23515929, 25195038, 26071053, 27044827, 27282995, 28302137, 28357915, 28553616, 29266344, 29473332, 29946110 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	35562919	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23200913, 31718641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	24194940	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	21382862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26983464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26983464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24936140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	20332486, 21115923, 7485386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	18162764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	12390529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	27664470		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	27664470		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	18162764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	15688424, 16651630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	36258150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	27820874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Suspect	Glaucoma	CTD_human_DG	24691439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21697087, 30359578, 8586464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29538296, 31390836, 39652629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21697087, 30359578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25982477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	19107326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	32733636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28148966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	10430059, 11251981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	10430059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	34306318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	33170831	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	24036084	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	27432584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	30181379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	12915480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21062387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29103159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30802639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31084986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	24239558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28513228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	14604972, 27244197	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16942595	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19018773, 29749460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	18635891, 26883801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18635891, 37978501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	25978849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	21479580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	CTD_human_DG	20668000		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Iron Overload	Iron Overload	BEFREE	31499193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratosis Linearis with Ichthyosis Congenita and Sclerosing Keratoderma	Keratosis linearis-ichthyosis congenita-sclerosing keratoderma syndrome	Pubtator	20226437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26050121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	17652152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	21732477		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16005964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	33560385, 34032336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	25321472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15308577, 34376804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12915480, 21106240, 30795628, 7566973, 9315104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28398499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30919222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoblastoma	Lipoblastoma	BEFREE	29976943, 30850231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	25650275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	10347549, 10828883, 11126370, 11896599, 12168660, 12366807, 15286712, 15492825, 15720420, 15826835, 16414544, 16651630, 16959485, 17468515, 17586092 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	11278855, 12168660, 18517278, 18820664, 19037998, 22588557, 26604682, 30420727, 34089125, 37205634, 40540926, 7592643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	LHGDN	17468515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	11229517, 11278855, 12168660, 12169678, 12876210, 18517278, 18820664, 20017906, 20581806, 20863376, 22523595, 22588557, 25393000, 27158758, 29588491 View all (15 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	30793229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	10449603, 10584701, 10809905, 11126370, 11162437, 11229517, 11751490, 11802205, 12169678, 12366807, 1283316, 12907366, 12915480, 12930346, 15201968 View all (56 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liposarcoma, Myxoid	liposarcoma	CTD_human_DG	1283316, 7503811, 8510758		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liposarcoma, Myxoid	liposarcoma	ORPHANET_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liposarcoma, Pleomorphic	liposarcoma	BEFREE	15720420, 19037998, 7485386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	11229517, 25851712, 7520271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21365646, 21660448, 22400995, 26917416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	25387528, 28600667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21365646, 22400995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21150337, 25770212, 27931220, 30332761, 36521248, 36864513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26090483, 36114579, 38013304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27599983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18559596, 22234349, 26253462, 30809101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	16704435, 29356608, 30172345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	16870476, 31485671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	31485671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	19107326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	12366807, 7485386, 8143276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	10430059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10534579, 22960596, 29103159, 29291017, 29649984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	14604972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12888831, 26983464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16463383, 21504179, 28103535, 28332554, 29702190, 30709582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	30919222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28453460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12706007, 21700680, 24042854, 24990631, 25261723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10470115, 17355264, 26384350, 29744288, 29910063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20043261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16463383, 19276161, 19558691, 20116099, 20686221, 22496745, 26983464, 28202509, 29150287, 29592897, 30788202, 8058726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	21128778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18534616, 18852146, 20837473, 30529689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	31398886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	11297545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	14604972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10534579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	14604972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	14604972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	29957865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	9413226		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11198475, 16005964, 23624368, 9413226		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12168790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30550954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MELAS Syndrome	MELAS Syndrome	BEFREE	17276738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	37515398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29574669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	23412101, 29748013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21633399, 27895089	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28944856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmia syndromic 7	Microphthalmia	Pubtator	12169678, 19037998, 20017906, 25393000, 25650275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MICROPHTHALMIA, SYNDROMIC 7	Syndromic microphthalmia	BEFREE	10449603, 11751490, 15201968, 17252290, 18752119, 21115923, 22588557, 22995304, 25650275, 26865464, 27158758, 28192118, 29588491, 30468937, 30787173, 30898787, 8637704, 9315104 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	21368884, 33837631, 34306318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucolipidoses	Mucolipidosis	Pubtator	21727211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Epiphyseal Dysplasia	Multiple Epiphyseal Dysplasia	BEFREE	26499313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19779717, 26636288, 30824741, 32070879, 32878237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25422130, 27750397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18344911, 21382862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32640422	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	30446370		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16211284, 20116099, 29356608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	36494342	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20492726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	25450231		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	29725368, 30416776		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	30391828, 30528737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	11162437, 11229517, 11751490, 12169678, 12366807, 12876210, 12915480, 12930346, 15201968, 15688424, 15720420, 16005964, 16359533, 16651630, 16849546 View all (31 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoid/round cell liposarcoma	Myxoid Liposarcoma	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25607111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	39881366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10071988, 10430059, 10534579, 10584701, 10605700, 10803921, 11251981, 12366807, 16849546, 16959485, 17647282, 20492726, 21128778, 23200913, 23920321 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	CTD_human_DG	16400006		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural Tube Defect	BEFREE	28482072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11163539, 12111836, 12234979, 14645667, 23951005, 29948946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	16942595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	16942595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	22496745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28398499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	9413226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11948400, 21801305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19558691, 32086613	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	26655953		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	27481183	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	31689600		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ocular Hypertension	Ocular Hypertension	CTD_human_DG	24691439		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	37283761, 38090564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	38175691	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	31639651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	17095306, 30835896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30044535		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28453460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27233943	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27729194, 35668504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	14669326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14669326, 35656858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	31506423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillon-Lefevre Disease	Papillon-Lefevre Disease	BEFREE	19037998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	19447887, 27103567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30902789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30902789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	25320373, 30547695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	32571297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30423122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35288480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	28071725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12706007, 21700680, 24042854, 24990631, 25261723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34358932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	21318260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26883801, 30135303, 30560874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	26247732, 29425932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	19107326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	20971808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	27450084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Riboflavin Deficiency	Riboflavin deficiency	Pubtator	36014863	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	10982695, 15201968, 20017906, 7828148, 9785008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	16651630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	20017906, 30040819, 31232935, 34385184, 7592643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	7485386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30123071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	30123071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophies of Childhood	Spinal muscular atrophy	Pubtator	31381526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondyloepimetaphyseal disorder	Spondyloepimetaphyseal dysplasia	BEFREE	26499313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26983464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24964091	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	23361066, 28686850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	27664470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28869608, 30039987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10470115, 17355264, 26384350, 29744288, 29910063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12297725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29587440, 33393595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29291402, 30036660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	20043261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20043261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22691366, 30272326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	22157935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26116180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	30426803	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	22438966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17970084, 36431966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	30006153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	23012375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DDIT3 (DNA damage inducible transcript 3)