Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1647
Gene name	Growth arrest and DNA damage inducible alpha
Gene symbol	GADD45A
Synonyms (NCBI Gene)	DDIT1GADD45
Chromosome	1
Chromosome location	1p31.3
Summary	This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activatio

200

Show/Hide all (200)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005574	hsa-miR-374a-5p	ImmunoblotLuciferase reporter assayqRT-PCR	21274007
MIRT016251	hsa-miR-504-5p	qRT-PCR	20542001
MIRT029880	hsa-miR-26b-5p	Microarray	19088304
MIRT039859	hsa-miR-615-3p	CLASH	23622248
MIRT195823	hsa-miR-4282	PAR-CLIP	23592263
MIRT075736	hsa-miR-4678	PAR-CLIP	23592263
MIRT195824	hsa-miR-3613-3p	PAR-CLIP	23592263
MIRT195818	hsa-miR-5681b	PAR-CLIP	23592263
MIRT195820	hsa-miR-331-5p	PAR-CLIP	23592263
MIRT488305	hsa-miR-5701	PAR-CLIP	23592263
MIRT075723	hsa-miR-135b-3p	PAR-CLIP	23592263
MIRT488304	hsa-miR-607	PAR-CLIP	23592263
MIRT260128	hsa-miR-148b-3p	Next Generation Sequencing (NGS)qRT-PCR	27505319
MIRT734985	hsa-miR-4270	Western blottingqRT-PCR	33042452
MIRT005574	hsa-miR-374a-5p	Western blottingRNA-seqImmunofluorescenceqRT-PCR	32269736
MIRT195823	hsa-miR-4282	PAR-CLIP	23592263
MIRT075736	hsa-miR-4678	PAR-CLIP	23592263
MIRT195824	hsa-miR-3613-3p	PAR-CLIP	23592263
MIRT195818	hsa-miR-5681b	PAR-CLIP	23592263
MIRT195820	hsa-miR-331-5p	PAR-CLIP	23592263
MIRT488305	hsa-miR-5701	PAR-CLIP	23592263
MIRT075723	hsa-miR-135b-3p	PAR-CLIP	23592263
MIRT488304	hsa-miR-607	PAR-CLIP	23592263
MIRT1010189	hsa-miR-1237	CLIP-seq
MIRT1010190	hsa-miR-1248	CLIP-seq
MIRT1010191	hsa-miR-130a	CLIP-seq
MIRT1010192	hsa-miR-130b	CLIP-seq
MIRT1010193	hsa-miR-148a	CLIP-seq
MIRT1010194	hsa-miR-148b	CLIP-seq
MIRT1010195	hsa-miR-152	CLIP-seq
MIRT1010196	hsa-miR-301a	CLIP-seq
MIRT1010197	hsa-miR-301b	CLIP-seq
MIRT1010198	hsa-miR-3074-5p	CLIP-seq
MIRT1010199	hsa-miR-3666	CLIP-seq
MIRT1010200	hsa-miR-3667-3p	CLIP-seq
MIRT1010201	hsa-miR-374c	CLIP-seq
MIRT1010202	hsa-miR-376c	CLIP-seq
MIRT1010203	hsa-miR-4276	CLIP-seq
MIRT1010204	hsa-miR-4295	CLIP-seq
MIRT1010205	hsa-miR-454	CLIP-seq
MIRT1010206	hsa-miR-4778-3p	CLIP-seq
MIRT1010207	hsa-miR-4799-5p	CLIP-seq
MIRT1010208	hsa-miR-5096	CLIP-seq
MIRT1010209	hsa-miR-516a-3p	CLIP-seq
MIRT1010210	hsa-miR-548ae	CLIP-seq
MIRT1010211	hsa-miR-548aj	CLIP-seq
MIRT1010212	hsa-miR-548am	CLIP-seq
MIRT1010213	hsa-miR-548x	CLIP-seq
MIRT1010214	hsa-miR-579	CLIP-seq
MIRT1010215	hsa-miR-655	CLIP-seq
MIRT1010216	hsa-miR-659	CLIP-seq
MIRT1010189	hsa-miR-1237	CLIP-seq
MIRT1010190	hsa-miR-1248	CLIP-seq
MIRT1010217	hsa-miR-3124-3p	CLIP-seq
MIRT1010206	hsa-miR-4778-3p	CLIP-seq
MIRT1010208	hsa-miR-5096	CLIP-seq
MIRT1010214	hsa-miR-579	CLIP-seq
MIRT1010218	hsa-miR-587	CLIP-seq
MIRT1010202	hsa-miR-376c	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT1010189	hsa-miR-1237	CLIP-seq
MIRT1010190	hsa-miR-1248	CLIP-seq
MIRT1010191	hsa-miR-130a	CLIP-seq
MIRT1010192	hsa-miR-130b	CLIP-seq
MIRT1010193	hsa-miR-148a	CLIP-seq
MIRT1010194	hsa-miR-148b	CLIP-seq
MIRT1010195	hsa-miR-152	CLIP-seq
MIRT2232886	hsa-miR-2276	CLIP-seq
MIRT2232887	hsa-miR-296-5p	CLIP-seq
MIRT1010196	hsa-miR-301a	CLIP-seq
MIRT1010197	hsa-miR-301b	CLIP-seq
MIRT1010217	hsa-miR-3124-3p	CLIP-seq
MIRT2232888	hsa-miR-3545-3p	CLIP-seq
MIRT2232889	hsa-miR-361-3p	CLIP-seq
MIRT1010199	hsa-miR-3666	CLIP-seq
MIRT2232890	hsa-miR-3680	CLIP-seq
MIRT1010203	hsa-miR-4276	CLIP-seq
MIRT1010204	hsa-miR-4295	CLIP-seq
MIRT1010205	hsa-miR-454	CLIP-seq
MIRT2232891	hsa-miR-4680-5p	CLIP-seq
MIRT2232892	hsa-miR-4703-3p	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT2232893	hsa-miR-4772-3p	CLIP-seq
MIRT2232894	hsa-miR-512-5p	CLIP-seq
MIRT1010209	hsa-miR-516a-3p	CLIP-seq
MIRT2232895	hsa-miR-518a-5p	CLIP-seq
MIRT2232896	hsa-miR-527	CLIP-seq
MIRT1010210	hsa-miR-548ae	CLIP-seq
MIRT1010211	hsa-miR-548aj	CLIP-seq
MIRT1010212	hsa-miR-548am	CLIP-seq
MIRT1010213	hsa-miR-548x	CLIP-seq
MIRT1010218	hsa-miR-587	CLIP-seq
MIRT1010216	hsa-miR-659	CLIP-seq
MIRT1010191	hsa-miR-130a	CLIP-seq
MIRT1010192	hsa-miR-130b	CLIP-seq
MIRT1010193	hsa-miR-148a	CLIP-seq
MIRT1010194	hsa-miR-148b	CLIP-seq
MIRT1010195	hsa-miR-152	CLIP-seq
MIRT1010196	hsa-miR-301a	CLIP-seq
MIRT1010197	hsa-miR-301b	CLIP-seq
MIRT1010199	hsa-miR-3666	CLIP-seq
MIRT1010203	hsa-miR-4276	CLIP-seq
MIRT1010204	hsa-miR-4295	CLIP-seq
MIRT1010205	hsa-miR-454	CLIP-seq
MIRT1010210	hsa-miR-548ae	CLIP-seq
MIRT1010211	hsa-miR-548aj	CLIP-seq
MIRT1010212	hsa-miR-548am	CLIP-seq
MIRT1010213	hsa-miR-548x	CLIP-seq
MIRT1010216	hsa-miR-659	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT2536562	hsa-miR-1273e	CLIP-seq
MIRT2536563	hsa-miR-1283	CLIP-seq
MIRT2536564	hsa-miR-1321	CLIP-seq
MIRT1010193	hsa-miR-148a	CLIP-seq
MIRT1010194	hsa-miR-148b	CLIP-seq
MIRT1010195	hsa-miR-152	CLIP-seq
MIRT2536565	hsa-miR-2054	CLIP-seq
MIRT2536566	hsa-miR-299-5p	CLIP-seq
MIRT1010198	hsa-miR-3074-5p	CLIP-seq
MIRT2536567	hsa-miR-3143	CLIP-seq
MIRT2536568	hsa-miR-3162-5p	CLIP-seq
MIRT2536569	hsa-miR-3607-3p	CLIP-seq
MIRT2536570	hsa-miR-362-5p	CLIP-seq
MIRT1010200	hsa-miR-3667-3p	CLIP-seq
MIRT2536571	hsa-miR-3686	CLIP-seq
MIRT1010201	hsa-miR-374c	CLIP-seq
MIRT2536572	hsa-miR-375	CLIP-seq
MIRT1010202	hsa-miR-376c	CLIP-seq
MIRT1010203	hsa-miR-4276	CLIP-seq
MIRT2536573	hsa-miR-4280	CLIP-seq
MIRT2536574	hsa-miR-4302	CLIP-seq
MIRT2536575	hsa-miR-4326	CLIP-seq
MIRT2536576	hsa-miR-4328	CLIP-seq
MIRT2536577	hsa-miR-4642	CLIP-seq
MIRT2536578	hsa-miR-4652-3p	CLIP-seq
MIRT2536579	hsa-miR-4690-3p	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT2536580	hsa-miR-4739	CLIP-seq
MIRT2536581	hsa-miR-4756-5p	CLIP-seq
MIRT2536582	hsa-miR-4775	CLIP-seq
MIRT1010207	hsa-miR-4799-5p	CLIP-seq
MIRT2536583	hsa-miR-4803	CLIP-seq
MIRT2536584	hsa-miR-500a	CLIP-seq
MIRT2536585	hsa-miR-500b	CLIP-seq
MIRT2536586	hsa-miR-502-5p	CLIP-seq
MIRT2232894	hsa-miR-512-5p	CLIP-seq
MIRT2536587	hsa-miR-520d-5p	CLIP-seq
MIRT2536588	hsa-miR-524-5p	CLIP-seq
MIRT1010210	hsa-miR-548ae	CLIP-seq
MIRT1010211	hsa-miR-548aj	CLIP-seq
MIRT1010212	hsa-miR-548am	CLIP-seq
MIRT2536589	hsa-miR-548m	CLIP-seq
MIRT1010213	hsa-miR-548x	CLIP-seq
MIRT2536590	hsa-miR-590-3p	CLIP-seq
MIRT2536591	hsa-miR-606	CLIP-seq
MIRT1010215	hsa-miR-655	CLIP-seq
MIRT1010216	hsa-miR-659	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT2536562	hsa-miR-1273e	CLIP-seq
MIRT2536563	hsa-miR-1283	CLIP-seq
MIRT2536564	hsa-miR-1321	CLIP-seq
MIRT2536565	hsa-miR-2054	CLIP-seq
MIRT2536566	hsa-miR-299-5p	CLIP-seq
MIRT1010198	hsa-miR-3074-5p	CLIP-seq
MIRT2536567	hsa-miR-3143	CLIP-seq
MIRT2536568	hsa-miR-3162-5p	CLIP-seq
MIRT2536569	hsa-miR-3607-3p	CLIP-seq
MIRT2536570	hsa-miR-362-5p	CLIP-seq
MIRT1010200	hsa-miR-3667-3p	CLIP-seq
MIRT2536571	hsa-miR-3686	CLIP-seq
MIRT1010201	hsa-miR-374c	CLIP-seq
MIRT1010202	hsa-miR-376c	CLIP-seq
MIRT2536573	hsa-miR-4280	CLIP-seq
MIRT2536574	hsa-miR-4302	CLIP-seq
MIRT2536576	hsa-miR-4328	CLIP-seq
MIRT2536577	hsa-miR-4642	CLIP-seq
MIRT2536578	hsa-miR-4652-3p	CLIP-seq
MIRT2536579	hsa-miR-4690-3p	CLIP-seq
MIRT1999206	hsa-miR-4711-5p	CLIP-seq
MIRT2536580	hsa-miR-4739	CLIP-seq
MIRT2536581	hsa-miR-4756-5p	CLIP-seq
MIRT2536582	hsa-miR-4775	CLIP-seq
MIRT1010207	hsa-miR-4799-5p	CLIP-seq
MIRT2536583	hsa-miR-4803	CLIP-seq
MIRT2536584	hsa-miR-500a	CLIP-seq
MIRT2536585	hsa-miR-500b	CLIP-seq
MIRT2536586	hsa-miR-502-5p	CLIP-seq
MIRT2232894	hsa-miR-512-5p	CLIP-seq
MIRT2536587	hsa-miR-520d-5p	CLIP-seq
MIRT2536588	hsa-miR-524-5p	CLIP-seq
MIRT1010210	hsa-miR-548ae	CLIP-seq
MIRT1010211	hsa-miR-548aj	CLIP-seq
MIRT1010212	hsa-miR-548am	CLIP-seq
MIRT2536589	hsa-miR-548m	CLIP-seq
MIRT1010213	hsa-miR-548x	CLIP-seq
MIRT2536590	hsa-miR-590-3p	CLIP-seq
MIRT2536591	hsa-miR-606	CLIP-seq
MIRT1010215	hsa-miR-655	CLIP-seq
MIRT1010216	hsa-miR-659	CLIP-seq

Show/Hide all (13)

Transcription factor	Regulation	Reference
ATM	Activation	20164679
BRCA1	Activation	10962562;17428466;18025037
BRCA1	Repression	18350249
BRCA1	Unknown	11777930;12647291
JUND	Activation	17084916
NFYA	Activation	11525640
NFYA	Unknown	11420680
POU2F1	Activation	11525640
POU2F1	Unknown	11420680
POU5F1	Unknown	11704867
TP53	Activation	10566557
TP53	Repression	17344317;18350249
TP53	Unknown	10327059;12007564;15031557;16581545;18225552

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	10747892
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	23329839
GO:0005515	Function	Protein binding	IDA	20460379
GO:0005515	Function	Protein binding	IPI	12052864, 12716909, 15328371, 16189514, 17268471, 21722948, 21988832, 23820005, 32296183, 32814053, 33961781, 37398436
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9827804
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9827804
GO:0006281	Process	DNA repair	TAS	7973727
GO:0006915	Process	Apoptotic process	TAS	10828065
GO:0006974	Process	DNA damage response	IEA
GO:0007098	Process	Centrosome cycle	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0019900	Function	Kinase binding	IPI	20460379
GO:0033140	Process	Negative regulation of peptidyl-serine phosphorylation of STAT protein	IMP	23329839
GO:0042770	Process	Signal transduction in response to DNA damage	IMP	20160708
GO:0042803	Function	Protein homodimerization activity	IDA	20460379
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9827804
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IEA
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IMP	23329839
GO:0046330	Process	Positive regulation of JNK cascade	IDA	9827804
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	20460379
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	TAS	10747892
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071479	Process	Cellular response to ionizing radiation	IMP	20160708
GO:0071901	Process	Negative regulation of protein serine/threonine kinase activity	IMP	23329839
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	9827804
GO:1900745	Process	Positive regulation of p38MAPK cascade	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IMP	20160708

MIM	HGNC	e!Ensembl
126335	4095	ENSG00000116717

P24522

Protein name

Growth arrest and DNA damage-inducible protein GADD45 alpha (DNA damage-inducible transcript 1 protein) (DDIT-1)

Protein function

In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity (By similarity). Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and i

PDB

2KG4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01248	Ribosomal_L7Ae	21 → 123	Ribosomal protein L7Ae/L30e/S12e/Gadd45 family	Domain

Sequence

MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Sequence length

165

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHLORACNE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (155)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	15653712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	26993769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	26993769	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30138371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30138371	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	23335992, 7478567, 8834260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30138371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30138371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20131288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12175543, 24497971, 28577130, 31571910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	28086219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	15377844, 19728081, 29858376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15064713, 15377844, 15735726, 17764113, 18350249, 19728081, 30128181, 8834260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23706118, 33369440, 33369470, 40012020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10661348, 15772983, 19276161, 23151675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23114628, 37259059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12175543, 24497971, 28577130, 31571910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10101024, 20652500, 20686221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21944129	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28679648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11094305, 25958320, 26422378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	40012020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	10327059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10327059, 10661348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	12829999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	30227886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19757064, 20444249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17599061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28068431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28068431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27505319		★★★★★ ★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	26669670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28444170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	37259059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	30227886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	26596832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23793925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	22313682, 30961474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23793925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21734802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	31336611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28844958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	23616123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26871431, 28821714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27355563, 28445981, 28821714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27355563, 28821714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28445981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33885248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27505319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	37059745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	23706118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15837757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18087215	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33293495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	18413758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15744335, 24104471, 28086219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19298651, 31122263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19298651	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myeloid, Accelerated Phase	Myeloid Leukemia	BEFREE	28086219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	26993769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29386013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	29884649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20530689, 26596832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	37059745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12878869, 20652500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	16141330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20131288	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24082908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20131288, 31195707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25450267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15744335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	20150644, 28445981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15064713, 15735726, 17764113, 18350249, 19728081, 30128181, 8834260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12888831, 23793925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20652500, 20686221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29386013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11094305, 25958320, 26422378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	17474084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12171884, 19003803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	19003803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15527761, 19190346, 26171936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	19190346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15837757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	12175543, 24497971, 28577130, 31571910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10661348, 15353598, 15882169, 16141330, 17178890, 18472964, 18978177, 19003803, 19757064, 20686221, 22515981, 24104471, 26171936, 29515153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	10327059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19757064, 20444249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15123655, 15377844, 21120602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15735726, 18350249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	9413226		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10757041, 17703175, 21691232, 29515153, 9413226		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12168790, 17703175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17703175, 29515153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	25831048	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	16157202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28444170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	29386013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	21836608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28086219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	33293495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11094305, 11471486, 12171884, 14506229, 15744335, 15920752, 16157202, 16827157, 17163161, 18472964, 18978177, 19689359, 20652500, 22313682, 22515981 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11163539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25469469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	9413226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16827157, 20652500, 26993769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28844958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29459183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37962028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	18472964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	18472964, 19052873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	25958320		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11094305, 26422378		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	14506229, 17474084		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	17474084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	14506229, 19305429, 26422378	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12171884, 19003803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12171872, 16353139, 17230496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	19003803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33884928	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	25469469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	16311409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	15744335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15527761, 15736438, 19190346, 26171936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	26171936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic disease	Pubtator	26171936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17280610, 21734453, 24658029, 26171936	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	19190346		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	19190346		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26885618	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18501677, 30138371, 31195707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	18413758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	21508354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24336067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	19728081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28679648, 29386013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23793925, 30935686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25450267, 28108672, 29386013, 35390246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29228625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29663367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26518708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	21293478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	18413758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15837757		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	25015188, 31489901	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	15744335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30128181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35631261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Type II Mucolipidosis	Mucolipidosis	BEFREE	26596832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15270080	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	29931256		★★★★★ ★☆☆☆☆ Found in Text Mining only

GADD45A (growth arrest and DNA damage inducible alpha)