Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	164684
Gene name	WBP2 N-terminal like
Gene symbol	WBP2NL
Synonyms (NCBI Gene)	GRAMD7PAWP
Chromosome	22
Chromosome location	22q13.2
Summary	WBP2NL is a sperm-specific WW domain-binding protein that promotes meiotic resumption and pronuclear development during oocyte fertilization (Wu et al., 2007 [PubMed 17289678]).[supplied by OMIM, Mar 2008]

Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018697	hsa-miR-335-5p	Microarray	18185580
MIRT1489230	hsa-miR-1267	CLIP-seq
MIRT1489231	hsa-miR-1279	CLIP-seq
MIRT1489232	hsa-miR-2392	CLIP-seq
MIRT1489233	hsa-miR-337-3p	CLIP-seq
MIRT1489234	hsa-miR-34b	CLIP-seq
MIRT1489235	hsa-miR-3685	CLIP-seq
MIRT1489236	hsa-miR-384	CLIP-seq
MIRT1489237	hsa-miR-3914	CLIP-seq
MIRT1489238	hsa-miR-4423-5p	CLIP-seq
MIRT1489239	hsa-miR-4652-3p	CLIP-seq
MIRT1489240	hsa-miR-4747-5p	CLIP-seq
MIRT1489241	hsa-miR-4760-3p	CLIP-seq
MIRT1489242	hsa-miR-4778-5p	CLIP-seq
MIRT1489243	hsa-miR-505	CLIP-seq
MIRT1489244	hsa-miR-616	CLIP-seq
MIRT1489245	hsa-miR-7	CLIP-seq
MIRT1489246	hsa-miR-873	CLIP-seq
MIRT2147433	hsa-miR-1238	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0007343	Process	Egg activation	ISS	17289678
GO:0031490	Function	Chromatin DNA binding	IBA
GO:0033011	Component	Perinuclear theca	ISS	17289678
GO:0035039	Process	Male pronucleus assembly	ISS	17289678
GO:0036126	Component	Sperm flagellum	IDA	26116451
GO:0045893	Process	Positive regulation of DNA-templated transcription	IBA
GO:0050699	Function	WW domain binding	ISS	17289678
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IDA	26116451
GO:0061827	Component	Sperm head	IDA	26116451

MIM	HGNC	e!Ensembl
610981	28389	ENSG00000183066

Q6ICG8

Protein name

Postacrosomal sheath WW domain-binding protein (WW domain-binding protein 2-like)

Protein function

May play a role in meiotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02893	GRAM	5 → 135	GRAM domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis. {ECO:0000269|PubMed:17289678}.

Sequence

MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIF
ITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNG
DAIEFAQLMVKAASAAARGFPLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPA
GYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASPVRYGAPPLGYGAPPAGYGAPPLGYGA
PPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPQESTAAQAPENEASLP
SASSSQVHS

Sequence length

309

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	25417742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25417742, 26070530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30571493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30571493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	24907910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25417742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25417742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericarditis, Constrictive	Pericarditis	BEFREE	31248553		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPERMATOGENIC FAILURE 9	Spermatogenic Failure	BEFREE	27089467		★★★★★ ★☆☆☆☆ Found in Text Mining only

WBP2NL (WBP2 N-terminal like)