Gene Gene information from NCBI Gene database.
Entrez ID 163786
Gene name SAS-6 centriolar assembly protein
Gene symbol SASS6
Synonyms (NCBI Gene)
MCPH14SAS-6SAS6
Chromosome 1
Chromosome location 1p21.2
Summary The protein encoded by this gene is a central component of centrioles and is necessary for their duplication and function. Centrioles adopt a cartwheel-shaped structure, with the encoded protein forming the hub and spokes inside a microtubule cylinder. De
SNPs SNP information provided by dbSNP.
2
SNP ID Visualize variation Clinical significance Consequence
rs876661307 A>G Pathogenic Missense variant, coding sequence variant, intron variant
rs1193888919 ->T Likely-pathogenic Frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
112
miRTarBase ID miRNA Experiments Reference
MIRT026834 hsa-miR-192-5p Microarray 19074876
MIRT050698 hsa-miR-18a-5p CLASH 23622248
MIRT726657 hsa-miR-26a-5p HITS-CLIP 22473208
MIRT726656 hsa-miR-26b-5p HITS-CLIP 22473208
MIRT1326518 hsa-miR-101 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21725316, 22020124, 23511974, 24107630, 26638075, 28514442, 31722219, 32296183, 32814053, 33961781
GO:0005737 Component Cytoplasm IDA 22020124
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IBA
GO:0005813 Component Centrosome IDA 15665853, 21399614, 22349705, 24107630, 31722219
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609321 25403 ENSG00000156876
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UVJ0
Protein name Spindle assembly abnormal protein 6 homolog (HsSAS-6) (Spindle assembly defective protein 6)
Protein function Central scaffolding component of the centrioles ensuring their 9-fold symmetry (By similarity). Required for centrosome biogenesis and duplication: required both for mother-centriole-dependent centriole duplication and deuterosome-dependent cent
PDB 6YS4 , 6Z4A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16531 SAS-6_N 44 141 Centriolar protein SAS N-terminal Domain
PF18594 Sas6_CC 146 173 Sas6/XLF/XRCC4 coiled-coil domain Coiled-coil
Sequence
MSQVLFHQLVPLQVKCKDCEERRVSIRMSIELQSVSNPVHRKDLVIRLTDDTDPFFLYNL
VISEEDFQSLKFQQGLLVDFLAFPQKFIDLLQQCTQEHAKEIPRFLLQLVSPAAILDNSP
AFLNVVETNPFKHLTHLSLKL
LPGNDVEIKKFLAGCLKCSKEEKLSLMQSLDDATKQLDF
TRKTLAEKKQELDKLRNEWASHTAALTNKHSQELTNEKEKALQAQVQYQQQHEQQKKDLE
ILHQQNIHQLQNRLSELEAANKDLTERKYKGDSTIRELKAKLSGVEEELQRTKQEVLSLR
RENSTLDVECHEKEKHVNQLQTKVAVLEQEIKDKDQLVLRTKEAFDTIQEQKVVLEENGE
KNQVQLGKLEATIKSLSAELLKANEIIKKLQGDLKTLMGKLKLKNTVTIQQEKLLAEKEE
KLQKEQKELQDVGQSLRIKEQEVCKLQEQLEATVKKLEESKQLLKNNEKLITWLNKELNE
NQLVRKQDVLGPSTTPPAHSSSNTIRSGISPNLNVVDGRLTYPTCGIGYPVSSAFAFQNT
FPHSISAKNTSHPGSGTKVQFNLQFTKPNASLGDVQSGATISMPCSTDKENGENVGLESK
YLKKREDSIPLRGLSQNLFSNSDHQRDGTLGALHTSSKPTALPSASSAYFPGQLPNS
Sequence length 657
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Microcephaly 14, primary, autosomal recessive Pathogenic; Likely pathogenic rs876661307, rs763290832, rs2523730965, rs1406541512, rs1651181046 RCV000172831
RCV003229496
RCV003236350
RCV004799267
RCV001255652
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTOSOMAL RECESSIVE PRIMARY MICROCEPHALY CTD, Disgenet, Orphanet
CTD, Disgenet, Orphanet
CTD, Disgenet, Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SASS6-related disorder Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 26035073
★☆☆☆☆
Found in Text Mining only
Agenesis of Corpus Callosum Corpus callosum agenesis Pubtator 36739862 Associate
★☆☆☆☆
Found in Text Mining only
Agenesis of corpus callosum Agenesis Of Corpus Callosum HPO_DG
★☆☆☆☆
Found in Text Mining only
Autosomal Recessive Primary Microcephaly Microcephaly BEFREE 24951542, 30639237
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autosomal Recessive Primary Microcephaly Microcephaly ORPHANET_DG 24951542
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autosomal recessive primary microcephaly Microcephaly Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autosomal Recessive Primary Microcephaly Primary microcephaly Pubtator 36739862 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colon Carcinoma Colon Carcinoma BEFREE 26035073
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 26035073
★☆☆☆☆
Found in Text Mining only
Delirium Delirium BEFREE 29045280
★☆☆☆☆
Found in Text Mining only