ACE (angiotensin I converting enzyme)

Gene

• Entrez ID: 1636
• Gene name: Angiotensin I converting enzyme
• Gene symbol: ACE
• Synonyms (NCBI Gene): ACE1, CD143, DCP, DCP1
• Chromosome: 17
• Chromosome location: 17q23.3
• Summary: This gene encodes an enzyme involved in blood pressure regulation and electrolyte balance. It catalyzes the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulatin

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1799752	->TTTTTTTTTTTGAGACGGAGTCTCGCTCTGTCGCCCATACAGTCACTTTT	Drug-response	Intron variant
rs121912703	C>T	Pathogenic	Coding sequence variant, missense variant
rs121912704	C>A,G,T	Pathogenic	Coding sequence variant, genic upstream transcript variant, synonymous variant, stop gained
rs367797185	C>T	Pathogenic, uncertain-significance	Stop gained, upstream transcript variant, genic upstream transcript variant, coding sequence variant
rs387906576	TGGA>-	Pathogenic	Frameshift variant, upstream transcript variant, genic upstream transcript variant, coding sequence variant
rs397514688	C>T	Pathogenic	Stop gained, upstream transcript variant, genic upstream transcript variant, coding sequence variant
rs397514689	C>T	Pathogenic	Stop gained, coding sequence variant
rs761345398	G>A	Likely-pathogenic	Coding sequence variant, genic upstream transcript variant, missense variant, upstream transcript variant
rs771053807	->GTTCCA	Likely-pathogenic	Upstream transcript variant, inframe insertion, genic upstream transcript variant, coding sequence variant
rs778390161	G>A	Likely-pathogenic	Splice acceptor variant
rs779188587	G>A,C	Likely-pathogenic	Splice donor variant, intron variant
rs779422412	C>T	Pathogenic	Stop gained, genic upstream transcript variant, coding sequence variant
rs797045079	CTCGGGCCGCCGGGGGCCGG>-	Likely-pathogenic, pathogenic	Genic upstream transcript variant, coding sequence variant, frameshift variant
rs1357918249	C>T	Likely-pathogenic	Missense variant, genic upstream transcript variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018383	hsa-miR-335-5p	Microarray	18185580
MIRT762467	hsa-miR-1324	CLIP-seq
MIRT762468	hsa-miR-148a	CLIP-seq
MIRT762469	hsa-miR-148b	CLIP-seq
MIRT762470	hsa-miR-152	CLIP-seq
MIRT762471	hsa-miR-4640-5p	CLIP-seq
MIRT762472	hsa-miR-4697-3p	CLIP-seq
MIRT762473	hsa-miR-4726-5p	CLIP-seq
MIRT762474	hsa-miR-520f	CLIP-seq
MIRT762475	hsa-miR-635	CLIP-seq
MIRT762476	hsa-miR-636	CLIP-seq
MIRT762477	hsa-miR-4436b-3p	CLIP-seq
MIRT762478	hsa-miR-4459	CLIP-seq
MIRT762479	hsa-miR-4716-3p	CLIP-seq
MIRT762480	hsa-miR-4722-5p	CLIP-seq
MIRT762481	hsa-miR-4728-5p	CLIP-seq
MIRT762482	hsa-miR-513a-3p	CLIP-seq
MIRT762483	hsa-miR-765	CLIP-seq
MIRT2165988	hsa-miR-1587	CLIP-seq
MIRT2165989	hsa-miR-4492	CLIP-seq
MIRT2165990	hsa-miR-4498	CLIP-seq
MIRT2165991	hsa-miR-4656	CLIP-seq
MIRT2165992	hsa-miR-4675	CLIP-seq
MIRT2165993	hsa-miR-4741	CLIP-seq
MIRT2165994	hsa-miR-762	CLIP-seq
MIRT2674220	hsa-miR-4290	CLIP-seq
MIRT2674221	hsa-miR-4685-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREM	Activation	8901568
EGR1	Activation	12433834
EGR1	Unknown	14679188
HIF1A	Activation	19592460
SP3	Unknown	14679188

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	IEA
GO:0001822	Process	Kidney development	IMP	16116425
GO:0001822	Process	Kidney development	ISS
GO:0001974	Process	Blood vessel remodeling	IC	1668266
GO:0002003	Process	Angiotensin maturation	IBA
GO:0002003	Process	Angiotensin maturation	IC	1668266
GO:0002003	Process	Angiotensin maturation	IDA	1320019, 4322742, 6270633, 11432860
GO:0002003	Process	Angiotensin maturation	IEA
GO:0002019	Process	Regulation of renal output by angiotensin	IC	1668266
GO:0002034	Process	Maintenance of blood vessel diameter homeostasis by renin-angiotensin	IDA	1567413, 26420482
GO:0002446	Process	Neutrophil mediated immunity	IEA
GO:0002446	Process	Neutrophil mediated immunity	ISS
GO:0002474	Process	Antigen processing and presentation of peptide antigen via MHC class I	TAS	23257181
GO:0003081	Process	Regulation of systemic arterial blood pressure by renin-angiotensin	IC	1668266
GO:0003081	Process	Regulation of systemic arterial blood pressure by renin-angiotensin	IMP	174834
GO:0003084	Process	Positive regulation of systemic arterial blood pressure	IBA
GO:0003084	Process	Positive regulation of systemic arterial blood pressure	IEA
GO:0003779	Function	Actin binding	IDA	16186248
GO:0004175	Function	Endopeptidase activity	IDA	15283675, 18495113
GO:0004180	Function	Carboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	IDA	6208535, 7683654
GO:0005515	Function	Protein binding	IPI	16186248, 22523556
GO:0005516	Function	Calmodulin binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	1668266, 7499427, 8253769, 11274151
GO:0005615	Component	Extracellular space	IDA	1668266, 4322742, 15283675
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IDA	11076943
GO:0005768	Component	Endosome	IDA	17077303
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	1668266, 8626443
GO:0005886	Component	Plasma membrane	IDA	16186248, 17077303
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	2554286
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008217	Process	Regulation of blood pressure	ISS	11303049
GO:0008233	Function	Peptidase activity	IDA	11604391, 16154999, 18077343
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IBA
GO:0008237	Function	Metallopeptidase activity	IDA	1320019, 1668266, 2849100, 17077303
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	ISS
GO:0008237	Function	Metallopeptidase activity	TAS	2554286
GO:0008238	Function	Exopeptidase activity	IDA	2983326
GO:0008240	Function	Tripeptidyl-peptidase activity	IDA	2983326
GO:0008241	Function	Peptidyl-dipeptidase activity	IBA
GO:0008241	Function	Peptidyl-dipeptidase activity	IDA	656131, 1320019, 1668266, 1851160, 2849100, 4322742, 6055465, 6208535, 6270633, 7683654, 7876104, 8257427, 11432860, 15283675, 17077303, 19773553, 20826823, 26403559
GO:0008241	Function	Peptidyl-dipeptidase activity	IEA
GO:0008241	Function	Peptidyl-dipeptidase activity	ISS	11303049
GO:0008241	Function	Peptidyl-dipeptidase activity	TAS	2554286
GO:0008270	Function	Zinc ion binding	IDA	12540854
GO:0008584	Process	Male gonad development	IEA
GO:0009897	Component	External side of plasma membrane	IDA	9449382
GO:0010608	Process	Post-transcriptional regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010814	Process	Substance P catabolic process	IDA	6208535
GO:0010815	Process	Bradykinin catabolic process	IDA	4322742, 6055465, 7683654
GO:0014910	Process	Regulation of smooth muscle cell migration	ISS
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019229	Process	Regulation of vasoconstriction	IC	1668266
GO:0031404	Function	Chloride ion binding	IDA	11432860, 12540854
GO:0031434	Function	Mitogen-activated protein kinase kinase binding	IPI	14615289
GO:0031711	Function	Bradykinin receptor binding	IPI	17077303
GO:0032943	Process	Mononuclear cell proliferation	IC	7876104
GO:0038166	Process	Angiotensin-activated signaling pathway	IDA	1567413
GO:0038166	Process	Angiotensin-activated signaling pathway	IEA
GO:0038166	Process	Angiotensin-activated signaling pathway	ISS
GO:0042311	Process	Vasodilation	IDA	4322742, 6055465
GO:0042445	Process	Hormone metabolic process	IDA	7683654
GO:0042447	Process	Hormone catabolic process	IDA	656131, 6270633, 7876104
GO:0042447	Process	Hormone catabolic process	IEA
GO:0042447	Process	Hormone catabolic process	ISS	11303049
GO:0043171	Process	Peptide catabolic process	IDA	4322742, 15283675
GO:0046872	Function	Metal ion binding	IEA
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0050435	Process	Amyloid-beta metabolic process	IDA	18495113, 19773553
GO:0050482	Process	Arachidonate secretion	IDA	17077303
GO:0051019	Function	Mitogen-activated protein kinase binding	IPI	14615289
GO:0060047	Process	Heart contraction	IEA
GO:0060047	Process	Heart contraction	ISS
GO:0060177	Process	Regulation of angiotensin metabolic process	IDA	1851160
GO:0060218	Process	Hematopoietic stem cell differentiation	IC	7876104
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070062	Component	Extracellular exosome	IDA	15326289, 21082674
GO:0070573	Function	Metallodipeptidase activity	IDA	7961923
GO:0071838	Process	Cell proliferation in bone marrow	IEA
GO:0071838	Process	Cell proliferation in bone marrow	ISS
GO:0086091	Process	Regulation of heart rate by cardiac conduction	IEA
GO:0086091	Process	Regulation of heart rate by cardiac conduction	ISS
GO:0097746	Process	Blood vessel diameter maintenance	IC	4322742
GO:1902033	Process	Regulation of hematopoietic stem cell proliferation	IC	7876104
GO:1902033	Process	Regulation of hematopoietic stem cell proliferation	IEA
GO:1902033	Process	Regulation of hematopoietic stem cell proliferation	ISS
GO:1903597	Process	Negative regulation of gap junction assembly	IEA
GO:1903597	Process	Negative regulation of gap junction assembly	ISS

Other IDs

• MIM: 106180
• HGNC: 2707
• e!Ensembl: ENSG00000159640

Protein

• UniProt ID: P12821
• Protein name: Angiotensin-converting enzyme (ACE) (EC 3.4.15.1) (Dipeptidyl carboxypeptidase I) (Kininase II) (CD antigen CD143) [Cleaved into: Angiotensin-converting enzyme, soluble form]
• Protein function: Dipeptidyl carboxypeptidase that removes dipeptides from the C-terminus of a variety of circulating hormones, such as angiotensin I, bradykinin or enkephalins, thereby playing a key role in the regulation of blood pressure, electrolyte homeostas
• PDB: 1O86, 1O8A, 1UZE, 1UZF, 2C6F, 2C6N, 2IUL, 2IUX, 2OC2, 2XY9, 2XYD, 2YDM, 3BKK, 3BKL, 3L3N, 3NXQ, 4APH, 4APJ, 4BXK, 4BZR, 4BZS, 4C2N, 4C2O, 4C2P, 4C2Q, 4C2R, 4CA5, 4CA6, 4UFA, 4UFB, 5AM8, 5AM9, 5AMA, 5AMB, 5AMC, 6EN5, 6EN6, 6F9R, 6F9T, 6F9U, 6F9V, 6H5W, 6H5X, 6QS1, 6TT1, 6TT3, 6TT4, 6ZPQ, 6ZPT, 6ZPU, 7Q24
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01401	Peptidase_M2	40 → 623	Angiotensin-converting enzyme	Family
  PF01401	Peptidase_M2	643 → 1221	Angiotensin-converting enzyme	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed, with highest levels in lung, kidney, heart, gastrointestinal system and prostate. {ECO:0000269|PubMed:10924499, ECO:0000269|PubMed:10969042, ECO:0000269|PubMed:12459472, ECO:0000269|PubMed:15671045}.; TISSUE SPE
• Sequence:

  MGAASGRRGPGLLLPLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQV
  LFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPQLRRI
  IGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASSR
  SYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDL
  EHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPF
  PDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVCH
  ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRRGANPGFHEAI
  GDVLALSVSTPEHLHKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS
  GRTPPSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQF
  HEALCKEAGYEGPLHQCDIYRSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLL
  KYFQPVTQWLQEQNQQNGEVLGWPEYQWHPPLPDNYPEGIDLVTDEAEASKFVEEYDRTS
  QVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRI
  IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKY
  EDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLER
  LFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPS
  APSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHAS
  AWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGD
  VLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGS
  ITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHE
  ALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSY
  FKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQW
  LLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS

• Sequence length: 1306

Pathways

KEGG:

Renin-angiotensin system
Renin secretion
Chagas disease
Coronavirus disease - COVID-19
Hypertrophic cardiomyopathy
Diabetic cardiomyopathy

Reactome:

Metabolism of Angiotensinogen to Angiotensins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Abnormality of prenatal development or birth	Likely pathogenic; Pathogenic	rs397514688	RCV001814028	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ACE-related disorder	Likely pathogenic; Pathogenic	rs752411292, rs778759606, rs1568038811, rs2510688530, rs779188587, rs1278390159, rs754265941	RCV004552531 RCV004554240 RCV002308529 RCV004550717 RCV004550737 RCV004552580 RCV004548131	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital anomaly of kidney and urinary tract	Likely pathogenic; Pathogenic	rs1198993903	RCV001328043	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gastric cancer	Pathogenic	rs779188587	RCV005932772	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hemorrhage, intracerebral, susceptibility to	Likely pathogenic; Pathogenic	rs752411292, rs778759606, rs1568038811, rs2510686780, rs778615098, rs138873311, rs769063911, rs121912704, rs1404223383, rs779188587, rs397514689, rs1599142041, rs900084108, rs754265941	RCV005030019 RCV005030082 RCV005025787 RCV005025913 RCV005025929 RCV005029977 RCV005015050 RCV005016280 RCV005015180 RCV005027832 RCV002483044 RCV005021337 RCV002497495 RCV002493546	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hereditary angioedema with normal C1Inh	Pathogenic	rs1599142041	RCV001027407	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microvascular complications of diabetes, susceptibility to, 3	Likely pathogenic; Pathogenic	rs752411292, rs778759606, rs1568038811, rs2510686780, rs778615098, rs138873311, rs769063911, rs121912704, rs1404223383, rs779188587, rs397514689, rs1599142041, rs900084108, rs754265941	RCV005030019 RCV005030082 RCV005025787 RCV005025913 RCV005025929 RCV005029977 RCV005015050 RCV005016280 RCV005015180 RCV005027832 RCV002483044 RCV005021337 RCV002497495 RCV002493546	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Renal tubular dysgenesis	Pathogenic; Likely pathogenic	rs1599143221, rs758933315, rs797045079, rs367797185, rs121912704, rs387906576, rs778390161, rs779188587, rs397514688, rs397514689, rs775421383, rs1387186484, rs2049738010, rs1409924291, rs1198993903	RCV001329407 RCV001775300 RCV000190563 RCV000399495 RCV000019686 RCV000019687 RCV000416335 RCV000677667 RCV000043470 RCV000043471 RCV001175177 RCV001281165 RCV001281119 RCV001281120 RCV001726475	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Renal tubular dysgenesis of genetic origin	Likely pathogenic; Pathogenic	rs752411292, rs778759606, rs1005792910, rs1568038811, rs2510686780, rs778615098, rs367797185, rs1341633213, rs138873311, rs2510680823, rs2510687443, rs769063911, rs121912704, rs1404223383, rs779188587, rs397514689, rs1599142041, rs900084108, rs754265941	RCV005030019 RCV005030082 RCV004546668 RCV005025787 RCV005025913 RCV005025929 RCV004767179 RCV003236244 RCV005029977 RCV003338228 RCV003389369 RCV005015050 RCV005016280 RCV004547337 RCV004560469 RCV005027832 RCV002483044 RCV005021337 RCV002497495 RCV002493546	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angiotensin i-converting enzyme, benign serum increase	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anhydramnios	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ANKYLOSING SPONDYLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARRHYTHMIAS, CARDIAC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BERYLLIOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAKUT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
captopril response - Efficacy	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY RESTENOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COUGH	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSED MOOD	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISEASES OF MITRAL VALVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FABRY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GAUCHER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLYCOGEN STORAGE DISEASE TYPE V	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE, DIASTOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE PROLAPSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HENOCH-SCHOENLEIN PURPURA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS A	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PULMONARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, LEFT VENTRICULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, MALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACEREBRAL HEMORRHAGE	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEFT VENTRICULAR HYPERTROPHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcephaly	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITRAL VALVE PROLAPSE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial infarction, susceptibility to	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYTHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRE-ECLAMPSIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSES, SUBSTANCE-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal dysplasia, cystic, susceptibility to	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY TRACT DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC DISEASE OF MITRAL VALVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC MITRAL REGURGITATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Risk of requirement of invasive mechanical ventilation in patients with severe COVID-19	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA, OBSTRUCTIVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYMPTOMS OF DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC SHOCK SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR SYSTEM INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ABLEPHARON-MACROSTOMIA SYNDROME	Ablepharon macrostomia syndrome	BEFREE	12471298, 15578201, 20570668, 23270441		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	31033180		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	31033180		★☆☆☆☆ Found in Text Mining only
Acquired angioedema	Angioedema	BEFREE	18204284, 27113957		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	10844381, 28712073		★☆☆☆☆ Found in Text Mining only
Activated Protein C Resistance	Activated Protein C Resistance	BEFREE	20161734		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	15534175		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	10643899, 14872014, 17192785, 30820047, 9916793		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	16274774, 22333273, 28124399, 28973758, 30044377, 31105064, 31195108, 31255479, 8623745, 9322984, 9327770, 9364295		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	24819208		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	16753875		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	17163998, 24743610, 25070351, 28247528, 29594979		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	1592471, 17898867, 9140790		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	26084817		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	10629150		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	24591530		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	12099691, 12700041, 16384981, 21417676, 31250582		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	12099691		★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	20146651		★☆☆☆☆ Found in Text Mining only
Allanson Pantzar McLeod syndrome	Allanson Pantzar McLeod Syndrome	CTD_human_DG	16116425, 20454656		★☆☆☆☆ Found in Text Mining only
Allanson Pantzar McLeod syndrome	Allanson Pantzar McLeod Syndrome	ORPHANET_DG	16116425, 22095942		★☆☆☆☆ Found in Text Mining only
Allanson Pantzar McLeod syndrome	Allanson Pantzar McLeod Syndrome	BEFREE	20454656, 21695262, 24163131, 25899979, 30058238, 30071301		★☆☆☆☆ Found in Text Mining only
Allanson Pantzar McLeod syndrome	Allanson Pantzar McLeod Syndrome	CLINVAR_DG	22095942		★☆☆☆☆ Found in Text Mining only
Allanson Pantzar McLeod syndrome	Allanson Pantzar McLeod Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Allanson Pantzar McLeod syndrome	Allanson Pantzar McLeod Syndrome	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	15112973, 16926975, 17014625, 24150611, 24637107, 25341696, 28886328		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	29582789		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	29582789		★☆☆☆☆ Found in Text Mining only
Alopecia universalis	Alopecia	BEFREE	29582789		★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	3022587		★☆☆☆☆ Found in Text Mining only
Alport Syndrome	Alport Syndrome	BEFREE	22903660, 24262794, 24988067, 26248473, 26487288, 27287265, 30724107, 8659493		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10567488, 10978362, 11015454, 11501342, 16642441, 20121884, 21297258, 24679048, 26884824, 27546928, 28099631, 34937778, 35011591, 39378208, 39794838	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	10643899, 14872014, 17192785, 30820047, 9916793		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	10567488, 11018310, 11078932, 11328206, 11992568, 14872014, 16399887, 17401152, 20625269, 26884824, 27398980		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	10643899, 14872014, 17192785, 30820047, 9916793		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	10643899, 14872014, 17192785, 30820047, 9916793		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	29777097		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	10643899, 14872014, 17192785, 30820047, 9916793		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	20625269, 29891744, 30040721		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	20030666		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30379106		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	11300459	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16172283, 18156303, 25656761, 27925507, 30697681, 31490340		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	Pubtator	18156303	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia Sickle Cell	Sickle cell anemia	Pubtator	17393952	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	28672087		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	10882751, 15858940, 22245237	Associate	★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	10747309, 9364295	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	11451295	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	11451295, 9364295	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	28281389	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	28377021, 8623745, 9285181, 9364295		★☆☆☆☆ Found in Text Mining only
Angioedema	Angioedema	Pubtator	18025295	Associate	★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	22185738, 25134986, 27788882		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	17713861, 22876137, 26186891		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	LHGDN	17713861		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	19212105		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	23891037		★☆☆☆☆ Found in Text Mining only
Antithrombin III Deficiency	Antithrombin Deficiency	BEFREE	18204284		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28754072, 30802732		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28754072, 30802732		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	21570325, 22245237, 23248206, 23587545, 25080510, 25155622, 27858843		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	21570325, 27858843	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	11352521, 15694792, 21570325, 23348634	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	22245237, 25120286, 25237166	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	10426973, 11352521, 12127851, 15694792, 18550062, 18718603, 20655774, 21570325, 22271804, 23587545, 24801553, 27533781, 27641464, 28160528, 28616354, 29175038, 31473210		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	15694792		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	19713682, 25237166	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	17673063		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	11300459		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	10532509, 11300459, 31711153, 8800593		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	LHGDN	15311863		★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	8675669		★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	11446493, 19716087, 24389577, 32555355	Associate	★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	19126662		★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	19126662	Associate	★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	17393952	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10493570, 10532681, 10642324, 10653135, 10678281, 10880412, 11079661, 11941276, 12143941, 12484511, 12833177, 14757856, 14989558, 15123520, 15475831, 15694930, 15809232, 17264090, 17285438, 17298481, 17611909, 17852816, 18298340, 18498093, 19754391, 20364300, 20504763, 21296594, 21322770, 22456784, 23540412, 26670794, 27179719, 27858843, 28186543, 28190172, 29199539, 29943232, 30148999, 30191985, 30521887, 30878369, 31370787, 31615657, 7614074, 8773433, 8781765, 9115957, 9200271, 9261253, 9555861, 9667803, 9678776		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	21127137	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30412852		★☆☆☆☆ Found in Text Mining only
Arthritis Sacroiliac	Sacroiliac arthritis	Pubtator	22876137	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	17440728, 17713861, 19930490		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	LHGDN	17713861		★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	22425118		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10197222, 10200023, 10227270, 10390412, 11030378, 11153913, 15115168, 15510584, 17014625, 18727619, 19383228, 19423314, 19484664, 20868478, 20880211, 21889830, 22361338, 22741763, 27581935, 30254660, 9003211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	15115168		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	10493570, 10532681, 10642324, 10653135, 10678281, 10880412, 11079661, 11941276, 12143941, 12484511, 12833177, 14757856, 14989558, 15123520, 15475831, 15694930, 15809232, 17264090, 17285438, 17298481, 17611909, 17852816, 18298340, 18498093, 19754391, 20364300, 20504763, 21296594, 21322770, 22456784, 23540412, 26670794, 27179719, 27858843, 28186543, 28190172, 29199539, 29943232, 30148999, 30191985, 30521887, 30878369, 31370787, 31615657, 7614074, 8773433, 8781765, 9115957, 9200271, 9261253, 9555861, 9667803, 9678776		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10747309, 11079661, 12484511, 14757856, 15964916, 17298481, 19021774, 21127137, 22456784, 24452940, 26735603, 27858843, 28186543, 31370787, 34747787	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	10807475, 12166654, 12687832, 14631130, 15023884, 16818212, 17113662, 17556195, 17927479, 18037749, 18496132, 19117407, 19665460, 19932491, 20636314, 20826259, 21056700, 21076147, 21436211, 23876437, 24270955, 26041129, 27179719, 28393567, 28771512, 28980280, 29371376, 29381974, 30057228, 30067937, 30238709, 31375968		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	10807475, 17556195, 18037749, 19648063, 21436211, 24270955, 27179719	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	15331425		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	LHGDN	17556195, 18496132, 19117407		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrioventricular Septal Defect	Atrioventricular septal defect	BEFREE	21740877		★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	20381197		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	27082637		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	27082637		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	27082637	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10672133, 16044257, 19706421, 20541774, 23278772, 24680475, 29582789, 31528333		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10672133	Associate	★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	BEFREE	23278772		★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	30088535		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	20030666		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	31198195	Associate	★☆☆☆☆ Found in Text Mining only
Azotemia	Azotemia	BEFREE	10714086		★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	29067654, 30564867		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	15045629, 15961928, 19255721, 22277255, 23065219, 23455487		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	LHGDN	15961928		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	15961928, 24188936	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11745693, 20026870, 22667764, 31605676, 31695843		★☆☆☆☆ Found in Text Mining only
BESTROPHINOPATHY, AUTOSOMAL RECESSIVE	Bestrophinopathy	BEFREE	26248473, 29282632, 29665833, 30132546		★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	22245237	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11027844, 11920854, 20010451, 21314245, 26989096, 30321766, 31630470		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	11027844, 11145009, 20010451, 21314245		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	35606706	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	28847993		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	29395178		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	21314245		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	25201786		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	15984009, 17922891, 9242959		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15534175		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Brain ischemia	Pubtator	9180106	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	12566298, 14583500, 15498791, 15802301, 16172223, 17023764, 17850737, 19286759, 20945417, 21109584, 21546404, 21638051, 23317229, 23700157, 24055489, 24961504, 25077884, 28186527, 28537988, 28577685, 28807926, 29202630, 29413755, 30235730, 31217631, 31642813		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	21109584	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17023764, 19286759, 25077884, 31642813	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	15610555, 16356438, 17726703, 18787808, 19571582, 20818980, 21314245, 21960125, 30287068		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	LHGDN	16356438		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	21960125	Associate	★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	27897403	Associate	★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	15470205, 27206329		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis	Calcinosis	Pubtator	15655270, 9561998	Associate	★☆☆☆☆ Found in Text Mining only
CAMPOMELIC DYSPLASIA	Campomelic Dysplasia	BEFREE	29883497		★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	24460287, 26600487, 31478246		★☆☆☆☆ Found in Text Mining only
Cancer of Urinary Tract	Urinary Tract Cancer	BEFREE	27906842		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18020099, 18630525, 21928698, 22064901	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	1592471, 21843521, 31203648		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	24203630	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15897638, 23006961, 23570557, 25208933, 25591763, 25945007	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	27801393		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11361058, 20303010, 22339037, 22538550, 25092717, 25354524, 25605160, 27100959, 29937931, 30355745, 31844581, 9441131		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22571796	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	19212105	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28809959, 33916968, 9708474	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24203630	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	23299466, 24203630, 29318704, 31570446		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22571796		★☆☆☆☆ Found in Text Mining only
Cardiac defects	Cardiac Defects	BEFREE	15128700		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	12675870	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	10371375, 10532509, 10678281, 12204015, 14767579, 16950195, 19390744, 23691019, 26739211, 27003392, 29292032, 30573480, 31008768, 7614074, 7773733, 8105309, 8644625, 8677872, 8869131, 9200271, 9270088, 9657983		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	LHGDN	14767579		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	19390744, 23199721, 29455790, 32638886	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	15151696, 25869724	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	7759715	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated with Left Ventricular Noncompaction	Dilated cardiomyopathy	Pubtator	20975235, 8752809	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	16614502, 18037749, 19390744, 20478904, 20975235	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Alcoholic	Cardiomyopathy	BEFREE	12204015, 31777538		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	10072245, 12356632, 17579251, 18165925, 20478902, 22015653, 23691019, 28120210, 9270088		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	LHGDN	18165925		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	10080429, 15151696, 16614502, 17579251, 18165925, 18997986, 23691019, 28120210, 30038875, 7759716, 7994801, 8105309, 8644625, 9270088		★☆☆☆☆ Found in Text Mining only
CARDIOMYOPATHY, FAMILIAL RESTRICTIVE, 1 (disorder)	Cardiomyopathy	BEFREE	18165925		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Hypertrophic, Familial	Cardiomyopathy	BEFREE	15928721, 9140839, 9270088		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	12898464	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10351920, 10354208, 10391391, 10406818, 10493570, 10520809, 10554703, 10560792, 10646957, 10669647, 10678281, 10759003, 10765051, 10773756, 10794598, 10821349, 10872702, 10874503, 10916115, 10937949, 10971153, 11014979, 11043512, 11071385, 11106322, 11134678, 11142763, 11256587, 11283791, 11305733, 11345362, 11401071, 11422397, 11437027, 11485372, 11498459, 11551873, 11707686, 11744804, 11985486, 12039661, 12196500, 12396747, 12425488, 12458570, 12476328, 12676161, 12692750, 12837457, 12898464, 14583500, 14602526, 15012913, 15012915, 15189494, 15332219, 15635071, 15772297, 15806540, 15875760, 16008546, 16009403, 16144506, 16175507, 16274774, 16492203, 16769256, 16924268, 17094051, 17174637, 17194198, 17243909, 17327458, 17429448, 17504232, 17556195, 17898539, 18037749, 18833197, 18946466, 19221299, 19255705, 19290794, 19371224, 19847428, 20384940, 20449805, 20629643, 20945417, 21038299, 21185205, 21244662, 21273224, 21412245, 21614448, 22064603, 22456784, 22647781, 22679279, 22757959, 22808171, 23055331, 23469169, 23876437, 24020846, 24350279, 24690767, 25237166, 25957879, 26125265, 26458572, 26985916, 27022914, 27417115, 27629735, 27778192, 27967225, 28096099, 28190172, 28202167, 28233239, 28384411, 28387887, 28552379, 28587581, 28626088, 28636634, 28700133, 28816537, 28847432, 28973758, 29157100, 29244531, 29330882, 29371275, 29464817, 29468656, 29509305, 29565029, 29598869, 29917143, 29990624, 30058413, 30148999, 30183974, 30256910, 30377258, 30413906, 30641607, 30707042, 30805791, 30986362, 30998765, 31042763, 31084594, 31088933, 31096810, 31337127, 31537750, 7586334, 7612972, 7713109, 7734106, 7850408, 7850980, 7955173, 8533773, 8538349, 8598840, 8644625, 8743524, 8772691, 8773433, 8785402, 8869132, 8872813, 8903616, 8903617, 8989728, 9020385, 9084932, 9267703, 9324115, 9327710, 9364580, 9428619, 9433518, 9441131, 9486084, 9603531, 9678776, 9708474, 9717050, 9740630, 9761238, 9794739, 9830503, 9918518		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	10484574, 10520809, 10652033, 10794598, 10916115, 11401071, 12692750, 12733698, 12898464, 12938141, 15012913, 15635071, 15964916, 17556195, 18037749, 18946466, 19221299, 19713682, 20449805, 21038299, 21127137, 21273224, 21614448, 22456784, 22679279, 22808171, 23055331, 23469169, 23609427, 24679048, 25237166, 25577762, 26125265, 26458572, 27030424, 28973758, 29058472, 29455790, 31042763, 32882331, 34930451, 35011591, 8533773, 8598840, 9708474	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	11498459, 14657821, 16544732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	11985486, 12669427, 12898464, 16018179, 16476718, 19221299		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	BEFREE	10701811		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	12484511, 17298481, 20134102, 21127137, 9678776	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	11155741, 11387483, 12484511, 15809232, 17298481, 20134102, 21984781, 29459079, 8903616, 8906516, 9678776		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	10354208, 12454231, 21819925, 7631331		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	19369957, 21127137	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	28370589		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	21873656, 30733210		★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	17908703, 18320184, 23107763, 23411129, 26222869, 29028160		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	CTD_human_DG	30097691		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central hypothyroidism	Central hypothyroidism	BEFREE	30450996		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	27884212		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	25201786		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	21339657	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Cerebral Infarction	BEFREE	11155741, 11859923, 14500990, 14641479, 16019571, 9242959, 9443775		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	14641479, 16775386, 18387982, 21421656, 22333273, 32683396, 34087973, 34747787	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	26710338	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	25201786		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10653133, 10653135, 10701810, 10949530, 11071585, 11155741, 11596779, 11720769, 11882570, 12925557, 14643574, 14990394, 15277638, 15699449, 15858957, 16446094, 16741184, 16791358, 17171228, 17299437, 17522061, 17537156, 17922891, 18027070, 18347611, 18551012, 18586276, 19596363, 19706421, 20300047, 20402757, 20606435, 21194526, 24732371, 25015258, 26588586, 28190172, 28627932, 29228591, 29381974, 29549467, 29739234, 30024023, 30554134, 30673886, 30875807, 31168785, 31445827, 31635965, 31668726, 31802381, 31849284, 7631331, 7990099, 8610309, 8620347, 8784123, 8903617, 9489536, 9533415, 9733227, 9918518		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	CTD_human_DG	15534175		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	LHGDN	17537156, 17922891		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	10669647, 11155741, 11720769, 11859923, 11861692, 12006218, 12039661, 12454231, 12925557, 15465635, 15858957, 19596363, 21157371, 23278516, 26159191, 30048164, 7631331, 8610309, 8653866, 9242959, 9273825, 9667803, 9785588		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	22723444, 34747787	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	20482751		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	27485363		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	20482751		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	19268079		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	19268079	Associate	★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	32638886	Associate	★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	31388039		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	11153913, 22361338		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	27267998, 28555163, 30452740		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	30458228		★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	11568784		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	21477733		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	18702808, 20524904, 22456784	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	11401115, 12911874, 15012914, 15012915, 15121491, 15523323, 22939041, 25869724, 26847573, 27365454, 28190577, 28325523, 28982370, 29895587, 30235455, 30691552, 30931184, 31370952, 31411383, 8040271, 9754589		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 3	Kidney Disease	BEFREE	28186543, 29240784		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	10099885, 10328464, 10430974, 10616844, 10620209, 10773756, 10831637, 10916074, 10983692, 11136175, 11200871, 11422735, 11525534, 11733623, 11918733, 11961010, 11979350, 12119485, 12172761, 12396747, 12675870, 12697976, 12728975, 12832734, 13679477, 14579936, 14600431, 14686639, 15012717, 15036826, 15045574, 15946912, 16006956, 16105049, 16215641, 16385653, 16525944, 16791616, 17199794, 17303584, 17429318, 17601378, 18629615, 19076285, 19288324, 21092187, 21163122, 21421653, 22173253, 22385293, 22903660, 23060471, 23166630, 23477970, 24988067, 26995302, 27633502, 28177196, 28279964, 28353612, 29208203, 29216260, 29498216, 29794446, 29808610, 29982608, 30128941, 30343892, 30840289, 31407377, 7593601, 8785402, 9259580, 9291178, 9434071, 9590186, 9820440		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	10430974, 10916074, 11313676, 11525534, 11544438, 12172760, 12396747, 14579936, 16006956, 16672053, 16960460, 18550651, 19293592, 20149750, 21309964, 22147663, 24498151, 24907556, 26420894, 26440392, 26741142, 26995302, 27050505, 27412800, 27748299, 27753685, 28075040, 28237959, 28244896, 28406186, 28415944, 28445490, 28449154, 28542215, 28598381, 28666408, 28802945, 28872780, 28873219, 28888268, 28930715, 28992758, 29079468, 29193639, 29208203, 29240784, 29699885, 29767459, 29848495, 29910024, 29970016, 30015556, 30140068, 30168046, 30201547, 30305036, 30320620, 30371331, 30403908, 30797615, 30804406, 30823871, 30898362, 30898450, 30935637, 30948820, 30992195, 31096810, 31133455, 31182139, 31196659, 31203280, 31214611, 31278281, 31498767, 31521117, 31573641, 31619367, 31663151, 31704188, 31741437, 31770762, 31776309, 7593601, 9259580, 9269704, 9434071, 9590186		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	16672053		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26573706		★☆☆☆☆ Found in Text Mining only
Chronic mountain sickness	Mountain sickness	BEFREE	18578644		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	10351920, 11029323, 12396747, 12832683, 14617263, 14682408, 15117739, 15233837, 15498534, 15875760, 16600946, 16936432, 18229571, 18258629, 18713090, 20156752, 22695028, 22757959, 23661462, 23702088, 24057178, 25511026, 27830153, 28085500, 28298371, 28325523, 28949063, 29716409, 30303835		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17400881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Pain	Chronic pain	Pubtator	17393952	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	11210078, 19236533		★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	24615782		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic schizophrenia	Schizophrenia	PSYGENET_DG	24615782		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Circadian Rhythm Disorders	Circadian Rhythm Disorders	BEFREE	28318412		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	12554626, 15743363, 29085215		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	31828731		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	35011591	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27014752, 28820392, 30415241, 30611671, 30725290		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17545615		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17898867, 18210757, 21843521, 25889770, 25990649, 28131779, 29032382, 29970692, 30636592, 31203648, 31348009, 31478086, 31478246, 31642377, 31753901		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17898867		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17898867, 29032382, 31203648, 35113855	Associate	★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	BEFREE	10765051, 12811592, 15644278, 19673907		★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	BEFREE	29850387		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	29085215, 29358853		★☆☆☆☆ Found in Text Mining only
Congenital absence of spleen	Asplenia	BEFREE	12359135		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	28169115, 30975293		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	18729069		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	15017542		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	28865601		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	26125265		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	30469459		★☆☆☆☆ Found in Text Mining only
Congenital posterior urethral valves	Congenital Posterior Urethral Valves	BEFREE	16006956, 20149750, 29534877		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	10072245, 10080429, 10097225, 10525494, 10532509, 10619441, 10937920, 10969042, 11168675, 11273991, 11401115, 11914098, 11985486, 12005216, 12356632, 12476935, 12700890, 12911874, 12921820, 1414889, 14602526, 15012914, 15012915, 15121491, 15320512, 15320851, 15485441, 15523323, 15542286, 15571830, 15686789, 15721506, 15827061, 15861031, 15940697, 16172283, 16226931, 16247204, 16501306, 16787247, 16818212, 16962475, 17094051, 17430683, 17452507, 18056057, 18261911, 18279468, 18351457, 18516385, 18594050, 18641516, 19050458, 19357768, 20189663, 20559955, 22015653, 22464776, 22498331, 22939041, 23543433, 23579966, 23592012, 23891037, 24270863, 24286577, 25150872, 25869724, 26588586, 26633885, 26847573, 27365454, 27530337, 27704319, 27746281, 27773450, 27800661, 27812677, 27842179, 27865662, 27881412, 27893331, 27912890, 27974807, 28166592, 28185171, 28189999, 28190577, 28209222, 28244205, 28285069, 28325523, 28329163, 28353316, 28371247, 28376504, 28460827, 28462600, 28484118, 28490619, 28501522, 28577679, 28587583, 28602366, 28656296, 28677661, 28679089, 28679681, 28701679, 28774396, 28790052, 28793821, 28834793, 28859261, 28862020, 28873219, 28888034, 28915848, 28941750, 28949063, 28970203, 28977050, 28980368, 28982370, 28982501, 28982651, 29032034, 29098619, 29101824, 29111304, 29137066, 29154427, 29177463, 29177815, 29183646, 29204682, 29220556, 29266804, 29283057, 29283224, 29331272, 29345425, 29369824, 29374807, 29446691, 29457258, 29464879, 29468912, 29469206, 29477488, 29489465, 29496021, 29527914, 29544929, 29547022, 29566753, 29617523, 29655829, 29713149, 29724164, 29731013, 29739234, 29767459, 29774407, 29776559, 29790603, 29895587, 29917003, 30050591, 30052809, 30054868, 30067937, 30103979, 30109716, 30156128, 30194623, 30235455, 30256890, 30296880, 30299270, 30299591, 30345485, 30484834, 30484837, 30518809, 30594849, 30691552, 30694579, 30697681, 30724013, 30817783, 30835055, 30836981, 30855313, 30876708, 30883861, 30887642, 30889487, 30895374, 30924021, 30931184, 30945522, 30948834, 31008768, 31016516, 31087629, 31172710, 31177795, 31179336, 31218508, 31240976, 31300503, 31339232, 31370798, 31370952, 31370961, 31375968, 31411383, 31420191, 31433752, 31447116, 31498767, 31498903, 31510768, 31545830, 31573715, 31598875, 31629013, 31637454, 31647614, 31663151, 31665724, 31668726, 31724271, 31728800, 31736333, 31772613, 31776309, 31785110, 31832789, 31843974, 7682566, 7713116, 7898096, 8040271, 8293772, 8752809, 8793580, 8835867, 9428619, 9486084, 9754589, 9796075, 9869506		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	18586661		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conn Adenoma	Conn Adenoma	BEFREE	28332881, 9140790		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	LHGDN	18383374		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21477733, 28224412, 28809959, 29098020		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	15164145, 15858940, 17222519, 28598221, 9128808		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10371375, 10391391, 10435047, 10462466, 10500308, 10554703, 10592684, 10615414, 10636265, 10731400, 10747309, 10765051, 10781757, 10794598, 10803441, 10862638, 10938484, 11134677, 11237541, 11250978, 11427204, 11485372, 11501342, 11522715, 11787479, 12574792, 12591842, 12669270, 12747597, 12833177, 12975417, 1328889, 14989558, 15016346, 15193812, 15223114, 15229388, 15320825, 15520830, 15699449, 16115488, 16764852, 16765625, 17285438, 17531579, 17562973, 18294050, 18298340, 18504336, 18520711, 18706898, 18832826, 19082699, 19502257, 20299978, 20364300, 20538738, 20655894, 20712529, 21567207, 21681430, 21769819, 22064603, 22245237, 22277253, 22307319, 22683751, 23407050, 23572029, 23661020, 24117346, 24391037, 24505095, 24827774, 24995885, 25189918, 25237166, 25342476, 25501306, 25867352, 27021566, 27162064, 27283338, 27633002, 27812677, 27895197, 27908822, 28196432, 28514598, 28627932, 28710178, 29141503, 29283057, 29846435, 30045724, 30225928, 30414419, 30684085, 30697681, 31370961, 31445827, 7556981, 7583453, 7586243, 7614074, 7634441, 7772074, 7805228, 7882471, 7913911, 8045571, 8170965, 8536956, 8548410, 8582133, 8644984, 8739332, 8752809, 8773433, 8784123, 8842348, 8866203, 8869131, 8903616, 8946109, 8989733, 9034401, 9115957, 9180106, 9200271, 9237022, 9254851, 9272166, 9298741, 9321743, 9322809, 9322984, 9351388, 9364295, 9377825, 9443774, 9498629, 9519327, 9519344, 9591757, 9678285, 9693941, 9699903, 9781631, 9796837, 9806472, 9832341, 9844142, 9857918, 9893731, 9920524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	14989558		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	10371375, 10391391, 10462466, 10488952, 10488959, 10500308, 10554703, 10592684, 10615414, 10731400, 10747309, 10765051, 10781757, 10794598, 10803441, 10862638, 11134677, 11237541, 11427204, 11485372, 11501342, 11522715, 11545752, 11716989, 11787479, 11791024, 12574792, 12591842, 12669270, 12747597, 12826927, 12833177, 12911874, 12975417, 1328889, 14989558, 15016346, 15193812, 15223114, 15229388, 15295089, 15320825, 15520830, 15543563, 15563875, 15699449, 15732661, 16115488, 16272779, 16764852, 16765625, 17285438, 17531579, 17562973, 18294050, 18298340, 18504336, 18520711, 18637188, 18706898, 18832826, 19082699, 19280995, 19634497, 20223792, 20299978, 20364300, 20529973, 20538738, 20655894, 20712529, 20854100, 21119571, 21148050, 21157371, 21567207, 21681430, 21769819, 22064603, 22245237, 22277253, 22297600, 22307319, 22345093, 22679279, 22683751, 23407050, 23661020, 24117346, 24391037, 24505095, 24827774, 24913112, 24995885, 25189918, 25237166, 25342476, 25501306, 25867352, 26588586, 26670794, 26985916, 27021566, 27162064, 27283338, 27812677, 27895197, 27908822, 28086795, 28196432, 28514598, 28627932, 28710178, 28816537, 29118227, 29281605, 29283057, 29846435, 30045724, 30225928, 30414419, 30684085, 30697681, 31370961, 31445827, 31727411, 7556981, 7583453, 7586243, 7614074, 7634441, 7772074, 7805228, 7882471, 7913911, 7955173, 8170965, 8536956, 8548410, 8644984, 8739332, 8752809, 8773433, 8784123, 8842348, 8866203, 8869131, 8925576, 8946109, 8989733, 9034401, 9084932, 9115957, 9200271, 9237022, 9254851, 9272166, 9298741, 9321743, 9322809, 9322984, 9351388, 9364295, 9377825, 9443774, 9519327, 9519344, 9561998, 9591757, 9667803, 9678285, 9693941, 9699903, 9769888, 9781631, 9796837, 9806472, 9822117, 9832341, 9844142, 9857918, 9893731, 9920524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	10636265, 10794598, 10803441, 11665795, 12798565, 12975417, 15858940, 22245237, 22307319, 22679279, 24505095, 24913112, 25501306, 27812677, 27895197, 28086795, 28196432, 32367400, 32584014, 34975123, 8541160, 8752809, 9264004, 9377825, 9561998	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	11665795, 16053717, 16116691, 16764852, 17118372, 18258525, 18294050, 18298340, 18637188, 19039150, 19157170		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	14989558		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Vasospasm	Coronary Artery Vasospasm	BEFREE	8675669		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	10747309, 11501342, 15635071, 16088850, 25342476, 37679988, 8170965, 9034401, 9561998, 9844142	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	10371375, 10391391, 10462466, 10463820, 10500308, 10554703, 10592684, 10615414, 10653136, 10731400, 10747309, 10765051, 10781757, 10794598, 10803441, 10862638, 10997795, 11134677, 11237541, 11345362, 11427204, 11485372, 11501342, 11522714, 11545752, 11787479, 11791024, 12574792, 12591842, 12669270, 12747597, 12833177, 12938141, 12975417, 1328889, 14989558, 15016346, 15193812, 15223114, 15295089, 15320825, 15520830, 15635071, 15699449, 15732660, 15732661, 15967849, 16088850, 16115488, 16764852, 16765625, 17174637, 17285438, 17531579, 17562973, 17579251, 18294050, 18298340, 18504336, 18520711, 18706898, 18832826, 19082699, 19355890, 20299978, 20364300, 20538738, 20655894, 20712529, 21567207, 21681430, 21722816, 21769819, 22064603, 22245237, 22277253, 22307319, 22683751, 23407050, 23661020, 24117346, 24391037, 24505095, 24827774, 24995885, 25189918, 25237166, 25342476, 25501306, 25867352, 26125265, 27021566, 27162064, 27283338, 27773540, 27812677, 27895197, 27908822, 28196432, 28514598, 28627932, 28710178, 28745786, 29283057, 29402648, 29522561, 29846435, 29934227, 30045724, 30225928, 30414419, 30684085, 30697681, 31370961, 31445827, 31483010, 31649528, 7556981, 7583453, 7586243, 7614074, 7634441, 7772074, 7773733, 7783537, 7805228, 7807499, 7882471, 7913911, 8170965, 8521557, 8536956, 8548410, 8644984, 8739332, 8752809, 8773433, 8784123, 8842348, 8866203, 8869131, 8907209, 8946109, 8989733, 9020385, 9034401, 9115957, 9200271, 9237022, 9254851, 9272166, 9298741, 9321743, 9322809, 9322984, 9351388, 9364295, 9377825, 9443774, 9519327, 9519344, 9539312, 9591757, 9603531, 9678285, 9699903, 9781631, 9796837, 9806472, 9832341, 9844142, 9857918, 9893731, 9920524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	LHGDN	16088850		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	CTD_human_DG	8170965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary restenosis	Pubtator	11665795, 11691520, 12205735, 12798565, 16272779, 28196432	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary Restenosis	BEFREE	11954942, 12217990, 18706898, 24098690, 24349507, 26195267		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary Restenosis	CTD_human_DG	9236417		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Stenosis	Coronary Stenosis	BEFREE	15295089, 18298340, 22679279, 7697839, 8644984, 8842348, 8866203, 9377825, 9693941		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	LHGDN	15295089		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	22679279, 9377825	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Thrombosis	Coronary Thrombosis	BEFREE	9796837		★☆☆☆☆ Found in Text Mining only
Coronary Vasospasm	Coronary vasospasm	Pubtator	8675669	Associate	★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	30101857, 31272959		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	24803075, 35352885, 9059468	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOMETAPHYSEAL DYSPLASIA, AUTOSOMAL DOMINANT	Craniometaphyseal Dysplasia	BEFREE	29883497		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	35250987, 36876951	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11569699, 17047091, 26823847, 31179321		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	17427637, 26823847	Associate	★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	16924268		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	24101265	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	12554626, 22874010		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	17163998	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	12005216, 12864773, 14597977, 14691571, 17938801		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12858018, 20845076, 23089924, 25178458, 26261641, 30765613, 31408841, 31785770		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	10400221, 10549798, 10818534, 11328206, 11402126, 12634288, 12736093, 16970648, 17270454, 18838196, 19716217, 21533863, 21833743, 26159191, 27038455, 27639288, 28511735, 28657841, 28865943, 29034839, 29081697, 30428833, 30820047, 30991105, 9129727, 9777422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia, Vascular	Dementia	BEFREE	10400221, 11328206, 15722183, 16465461, 16603315, 19073835, 9681639		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	LHGDN	15722183		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	15010349, 15949885, 16924268, 19439995, 19918760, 20639003, 22348891, 22688325, 22808171, 23157339, 24193727, 25694211, 27264499, 27639288, 28127518, 28760142, 28982269, 29132028, 30554134, 30898617, 31005595, 8641725		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	15927090, 22808171, 24193727, 28127518, 32367400, 36293037	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	25694211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	22808171	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30790328		★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	17651310	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	17651310		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	LHGDN	17651310		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	31195782		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	24591530		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	24591530	Associate	★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	10194187		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10189542, 10352194, 10499884, 10608470, 10652041, 11213892, 11313676, 11418149, 11938025, 11979350, 12032106, 12436341, 12449516, 12511525, 12742294, 14686639, 15213845, 15516153, 16765625, 17163998, 17222519, 18154415, 18413170, 18563171, 19247266, 19502258, 19857476, 20546161, 20565247, 20580725, 20854388, 21273224, 21421653, 21681430, 22064603, 22552531, 23065222, 24354906, 24737640, 25342476, 26458572, 27417115, 27748299, 27882442, 28177196, 28207279, 28273875, 28298367, 28377473, 28419972, 28556182, 28752555, 28816530, 28871349, 28929319, 28963291, 28982651, 29032706, 29091568, 29123192, 29177463, 29217352, 29227582, 29378484, 29390444, 29522561, 29665833, 29794446, 29884907, 29974027, 30185469, 30274353, 30296880, 30340893, 30420421, 30641607, 30684085, 30840289, 30898450, 31354627, 31472818, 31489273, 31728766, 7729604, 7909524, 8523387, 8582133, 8781765, 8840299, 8995725, 9025006, 9519756, 9727375, 9844142		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	24189507	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10189542, 10352194, 10391391, 10454299, 10499884, 10551431, 10608470, 10652041, 10759003, 10874503, 11213892, 11313676, 11418149, 11770799, 11893827, 11938025, 11979350, 12032106, 12436341, 12449516, 12511525, 12669270, 12742294, 12856080, 12921820, 14686639, 15213845, 15516153, 16272779, 16765625, 17163998, 17222519, 18154415, 18413170, 18563171, 19247266, 19502258, 19857476, 20546161, 20565247, 20580725, 20854388, 21273224, 21421653, 21681430, 22064603, 22552531, 23065222, 23130652, 23594830, 23973719, 24354906, 24737640, 25342476, 26458572, 27038455, 27417115, 27704319, 27748299, 27882442, 28141660, 28177196, 28207279, 28273875, 28298367, 28359068, 28373993, 28377473, 28419972, 28556182, 28626088, 28752555, 28816530, 28816537, 28860225, 28862933, 28867244, 28871349, 28911306, 28929319, 28963291, 28982651, 29032706, 29091568, 29123192, 29141503, 29155121, 29177463, 29217352, 29220556, 29227582, 29378484, 29390444, 29424910, 29522561, 29665833, 29794446, 29884907, 29974027, 30185469, 30212681, 30274353, 30296880, 30340893, 30420421, 30641607, 30684085, 30840289, 30898450, 31182139, 31354627, 31472818, 31489273, 31621640, 31663151, 31728766, 7729604, 7807499, 7909524, 8523387, 8582133, 8781765, 8840299, 8995725, 9025006, 9519756, 9544854, 9607207, 9727375, 9844142		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	10747309, 12081578, 12449516, 16088850, 19021774, 20134102, 20215707, 21421653, 22144991, 23042814, 23594830, 27748299, 33676010, 34489863, 35305693, 37432962, 8995725, 9607207, 9844142	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	15830186, 23833037, 35988927, 7783416, 8995725, 9509566	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35260304	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	12449516, 12964504, 14599112, 16395257, 18199798, 19126661, 19286757, 19502259, 20134102, 20305326, 22554825, 22679279, 23447104, 23468166, 24452036, 24505095, 26458572, 26982073, 28835639, 29694640, 33507688, 34489863, 36834424, 8170965, 8840299, 9264004, 9509566	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10082486, 10332539, 10474023, 10480521, 10499884, 11181802, 11181984, 11418149, 11428725, 12164879, 12637987, 12856080, 12873298, 14569094, 15189494, 15793268, 15830186, 16026372, 16186399, 16981144, 17333108, 18328310, 18413222, 19820429, 20121884, 20546161, 20854388, 22385293, 22811473, 23833037, 24562335, 27498976, 29091568, 29271523, 29337383, 29547046, 31384418, 7485124, 7556981, 7729604, 7783416, 7909524, 8314010, 8521557, 8523387, 8761013, 8806248, 8854649, 8995725, 9025006, 9084972, 9351388, 9354852, 9509566, 9551410, 9726242, 9781631, 9794100, 9794558, 9950302		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10023638, 10352194, 10364706, 10371375, 10391391, 10546020, 10608470, 10862639, 11007831, 11106834, 11200871, 11213892, 11399938, 11431175, 11522714, 11522715, 11640993, 11699055, 11723093, 11756350, 11770799, 11776100, 11941276, 11979350, 12031990, 12032106, 12165749, 12166538, 12419932, 12436341, 12449516, 12658909, 12660488, 12669270, 12728975, 12873298, 12964504, 14599112, 14686639, 14740347, 15516153, 15531537, 15639198, 15677791, 16108844, 16178979, 16395257, 16492203, 16621107, 16765625, 16936219, 16949519, 17044652, 17054027, 17478487, 17616353, 17624939, 18154415, 18291549, 18404607, 18413162, 18523145, 18541327, 18550651, 18551123, 18849600, 19034303, 19126661, 19207872, 19286757, 19286758, 19502259, 19655271, 19720797, 19857476, 20122911, 20160398, 20565247, 20580725, 20592051, 20664700, 21185205, 21207118, 21289265, 21670585, 21810896, 21993363, 22081332, 22113528, 22345093, 22385293, 22392877, 22554825, 22607040, 22679279, 23065222, 23249316, 23447104, 23458876, 23468166, 23745680, 23846111, 24452036, 24505095, 24549414, 25143334, 25656761, 26458572, 26491214, 26529791, 26782563, 26973293, 27460887, 27633502, 27638852, 27854313, 28008148, 28061036, 28115791, 28296280, 28446809, 28710178, 28835639, 28904068, 29190580, 29337383, 29378484, 29547046, 29602404, 29642146, 29704920, 29910024, 30032428, 30540657, 30571562, 30599943, 30793466, 31407377, 31428128, 31621640, 7477652, 7555560, 7583453, 7589881, 7773733, 8170965, 8521557, 8582133, 8596493, 8720609, 8772691, 8840299, 8941475, 9258285, 9264004, 9269698, 9322809, 9469501, 9544854, 9727375, 9730698, 9781631, 9844142		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	12165749, 15300633, 15639198, 17044652, 18154415		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	8743524		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28789938		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	10652041, 12081578, 16385653, 16612410, 17653210, 19034303, 22554825, 23833037, 27638852, 32901433, 36460431, 7783416, 8806248, 8854649, 9264004, 9509566, 9551410, 9844142	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	10023638, 10099885, 10189542, 10332539, 10352194, 10364706, 10391391, 10403609, 10480521, 10495473, 10499884, 10652041, 10727542, 10821348, 10862639, 10907125, 11007831, 11181802, 11428725, 11459212, 11640993, 11756350, 11776100, 12032106, 12081578, 12147786, 12396747, 12436341, 12554058, 12675860, 12682618, 12716812, 12722028, 12728975, 12873287, 14569094, 14686639, 15017527, 15331206, 15365253, 15830182, 16108844, 16215641, 16290123, 16385653, 16567826, 16612410, 16936219, 16960460, 17130203, 17143591, 17376814, 17616353, 17653210, 18154415, 18299464, 18389211, 18404607, 18413162, 18523141, 18849600, 19034303, 19077419, 19108684, 19207872, 19787680, 20689326, 20830509, 20854388, 21207118, 21406182, 21810896, 21942443, 22026967, 22113528, 22318421, 22385293, 22554825, 23260854, 23730990, 23833037, 23846111, 24737640, 25227524, 25587546, 26619914, 27498976, 27638852, 28177196, 28359068, 28390948, 28468961, 28712707, 28870804, 29185789, 29884907, 30092058, 30185469, 30242588, 30287151, 30372836, 30966785, 31194487, 31205872, 31384418, 31470292, 31543149, 7477652, 7485124, 7556981, 7729604, 7783416, 7819935, 7909524, 8314010, 8582133, 8596493, 8720609, 8761013, 8806248, 8854649, 8877296, 8989734, 8995725, 9025006, 9049480, 9075119, 9084972, 9247746, 9257079, 9258285, 9264004, 9269698, 9269704, 9350677, 9469501, 9498629, 9509566, 9551410, 9648845, 9660089, 9727374, 9730698, 9794558, 9830503, 9844142		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	10099885, 10857950, 23733546, 7909524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	11770799, 12147786, 12722028, 12803241, 15830182, 16936219, 17376814, 17616353, 18523141		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	24452036	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	31083769		★☆☆☆☆ Found in Text Mining only
Diabetic Polyneuropathies	Diabetic polyneuropathy	BEFREE	24452036		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	11106834, 12660488, 14615645, 18280446, 18523141, 19865794, 20565247, 20664700, 22249557, 23065222, 24452036, 26658948, 27854313, 29378484, 29484134, 30092018, 7555560, 8582133		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	16385653, 24452036, 26658948	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	10620209, 10652033, 10916115, 11168787, 11446493, 11527624, 11665795, 11893827, 12371972, 12628714, 12906984, 14718831, 15462112, 16247204, 16385653, 18199798, 18702808, 19126661, 19502257, 21332339, 22017506, 22144991, 23661462, 23847294, 24098401, 24188936, 30666042, 7759716, 8083349, 8541160, 8752809, 8800107, 9014990, 9083287, 9291178, 9364295, 9561998, 9607207	Associate	★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	11345361, 17023764, 17487825, 21162760, 21928698, 23199721, 26440392, 35190362, 8854649	Stimulate	★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic Dysplasia	BEFREE	15485441, 15542286, 17142213, 17367703, 17969487, 19142023, 20606435, 24452035		★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	34708878	Inhibit	★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	18652767, 19713682, 23079706, 25237166		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30067536		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	30088535		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	10781757, 10803441, 12032106, 18637188, 19034872, 19596363, 20816596, 21670585, 29141503		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	22144991, 34489863	Associate	★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	29859479		★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	26782563, 30882601		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	10459873, 17520398, 19717502, 20044877, 21436209, 25879409		★☆☆☆☆ Found in Text Mining only
Embryopathies	Embryopathy	BEFREE	27639441		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	19018872		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15527901, 27956412		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15531592, 17186537, 24571615		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	15531592, 17186537		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31680223		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	22832858, 31197659		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	11136175		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22571796		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	10553806, 11256792, 12837457, 17673929, 17889866, 20384940, 20629643, 23413140, 26821322		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	LHGDN	14671660		★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Erectile dysfunction	Pubtator	15292102, 17889866	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	15798469		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	15798469		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	15798469		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15798469	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Varices	Esophageal varix	BEFREE	11707686, 30236768		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	10082497, 10221352, 10335726, 10560791, 10642347, 10652033, 10673731, 10790347, 10821136, 10865821, 11043512, 11116113, 11244019, 11248758, 11345362, 11593574, 11687736, 12135330, 12165743, 12169209, 12372063, 12611423, 12652327, 12714874, 1314601, 1338766, 14504631, 15042113, 15386943, 15386947, 15642127, 15673060, 15869784, 15894833, 16002416, 16138565, 16314202, 16866021, 16877959, 17066084, 17083073, 17190732, 17196575, 17460369, 17487825, 18192839, 18200034, 18830250, 19126661, 19130799, 19863706, 20027122, 20087216, 21269061, 21779803, 21883781, 21993364, 22103580, 22974788, 23741507, 24098401, 24112034, 24192120, 24270955, 24354906, 24811208, 24860821, 25002132, 25357227, 26283679, 26305278, 26335431, 26579574, 27030424, 28534649, 28577874, 28598381, 29172745, 29546999, 30307755, 30518809, 30763326, 31486700, 7734106, 7807498, 7820539, 8076423, 8104754, 8293772, 8384838, 8390500, 8613205, 8686957, 8806984, 8957547, 8986921, 8989733, 9037328, 9140789, 9170002, 9197423, 9234834, 9321747, 9324115, 9524045, 9607178, 9607207, 9626985		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	10642347, 10652033, 10888379, 12135330, 12169209, 12371972, 12611423, 17190732, 17546276, 19126661, 23741507, 24015270, 24270955, 24354906, 25002132, 25357227, 25511213, 26283679, 27030424, 29172745, 29546999, 30307755, 33275245, 36355860, 37091860, 37200278, 9008252, 9607178, 9607207	Associate	★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	29394237		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	10643899, 14872014, 17192785, 30820047, 9916793		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	17182125		★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	29891744	Associate	★☆☆☆☆ Found in Text Mining only
Familial vesicoureteral reflux	Vesicoureteral Reflux	BEFREE	11409168, 12352339		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	21664615		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	17186537, 25735342		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	17186537		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	21361311		★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	17163998, 19307975		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	12677092, 19119484, 21546048, 21664615, 25453980, 26681055, 28822808, 29085215, 29358853, 30458228, 31348596		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	11474225, 12571380, 14610337, 14730545, 14986085, 19076285, 21652690, 28720684, 9434071, 9853248		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	LHGDN	14610337, 16272677		★☆☆☆☆ Found in Text Mining only
Focal Segmental Glomerulosclerosis, Not Otherwise Specified	Focal segmental glomerulosclerosis	BEFREE	11474225, 14730545, 14986085, 28720684, 9853248		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	31847529		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	31847529		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	26159191		★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	BEFREE	16855131		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	17035401		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	17035401		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	21864388	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	16435992		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	20723722	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	29196825		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gaucher Disease	Gaucher Disease	CTD_human_DG	12359135		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gaucher Disease	Gaucher disease	Pubtator	20696071, 29478818	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gaucher Disease	Gaucher Disease	BEFREE	29478818, 30115580		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gaucher Disease, Type 1	Gaucher Disease	BEFREE	12359135		★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 1	Gaucher Disease	CTD_human_DG	12359135		★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 2 (disorder)	Gaucher Disease	CTD_human_DG	12359135		★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 3 (disorder)	Gaucher Disease	CTD_human_DG	12359135		★☆☆☆☆ Found in Text Mining only
Generalized glycogen storage disease of infants	Glycogen Storage Disease	BEFREE	20308911, 30532252		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	11150371		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	33396443	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	LHGDN	15564761, 15864617		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	15564761, 15864617, 31675072		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	14997208		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	14997208		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25143323, 29017962		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25143323, 31312309	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	11422735, 28283858, 7703385, 9352153		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	19037561, 24452035, 34717572, 34867085, 7593601	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	12969126	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	12172760, 21346373, 30024858		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	16421456	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	20308911, 30532252		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	20308911, 30532252, 34734785	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type V	Glycogen Storage Disease	BEFREE	12666117, 16154688, 17616548, 17630210		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen Storage Disease Type V	Glycogen Storage Disease	CTD_human_DG	12666117		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen Storage Disease Type V	Glycogen Storage Disease	LHGDN	17616548, 17630210		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycosuria Renal	Renal glycosuria	Pubtator	18199798	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	11715070		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	30101857		★☆☆☆☆ Found in Text Mining only
Heart Block	Heart Block	BEFREE	19648063		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	28865601	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	10681079, 14643574, 16825089, 19648063, 20189663, 26529791, 26985916, 28233239, 29069972, 31676404, 7489615, 8644625, 8781765		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	19502257, 19648063, 20189663, 20364047, 20975235, 24389577, 7756072, 8083349	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	10072245, 10080429, 10097225, 10525494, 10619441, 10937920, 10969042, 11168675, 11273991, 11985486, 12076180, 12356632, 12476935, 12700890, 1414889, 14602526, 15320851, 15485441, 15523323, 15542286, 15571830, 15686789, 15721506, 15827061, 15861031, 15940697, 16226931, 16501306, 16962475, 17094051, 17430683, 17452507, 18261911, 18279468, 18351457, 18516385, 18594050, 18641516, 19050458, 19357768, 20559955, 22015653, 22464776, 22498331, 23543433, 23579966, 23592012, 23891037, 24270863, 24286577, 25150872, 25869724, 26847573, 27530337, 27704319, 27746281, 27773450, 27800661, 27812677, 27842179, 27865662, 27881412, 27893331, 27912890, 27974807, 28166592, 28185171, 28189999, 28209222, 28244205, 28285069, 28329163, 28353316, 28371247, 28376504, 28460827, 28462600, 28484118, 28490619, 28501522, 28577679, 28587583, 28602366, 28656296, 28677661, 28679089, 28679681, 28701679, 28774396, 28790052, 28793821, 28834793, 28859261, 28862020, 28873219, 28888034, 28915848, 28941750, 28949063, 28970203, 28977050, 28980368, 28982501, 29098619, 29101824, 29111304, 29137066, 29154427, 29177463, 29177815, 29183646, 29204682, 29220556, 29266804, 29283057, 29283224, 29331272, 29345425, 29369824, 29374807, 29446691, 29464879, 29477488, 29489465, 29496021, 29544929, 29547022, 29617523, 29655829, 29713149, 29724164, 29731013, 29739234, 29767459, 29776559, 29790603, 29917003, 30050591, 30054868, 30067937, 30103979, 30109716, 30156128, 30194623, 30256890, 30296880, 30299270, 30299591, 30345485, 30484834, 30484837, 30518809, 30694579, 30724013, 30817783, 30835055, 30836981, 30855313, 30876708, 30887642, 30924021, 30931184, 30945522, 30948834, 31008768, 31087629, 31172710, 31177795, 31179336, 31218508, 31240976, 31300503, 31339232, 31370798, 31370961, 31375968, 31420191, 31433752, 31447116, 31498767, 31498903, 31510768, 31545830, 31573715, 31598875, 31629013, 31637454, 31663151, 31665724, 31668726, 31724271, 31728800, 31736333, 31772613, 31776309, 31785110, 31832789, 31843974, 7713116, 8040271, 8752809, 8835867, 9428619, 9486084, 9869506		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	11401115, 15012913, 15012914, 15012915, 16247204, 18279468, 18516385, 20189663, 20975611, 21162760, 24270863, 25869724, 26633885, 27812677, 28977050, 33926172, 34359878, 7682566, 8752809	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	LHGDN	15121491, 18767410		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	18586661		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	20364047, 8040271	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure Diastolic	Heart failure	Pubtator	28513230	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Diastolic	Heart Failure	BEFREE	19021695, 19185300, 19752885, 26861937		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	18586661		★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	BEFREE	26583148		★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	9180368		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30009543		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	28186543	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	9690230	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	16521052, 20702504, 23151617, 28691415, 30854921, 9870486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C Chronic	Hepatitis c	Pubtator	15897638, 29641775	Associate	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	29406916		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	18059164		★☆☆☆☆ Found in Text Mining only
Hereditary nephritis	Hereditary Nephritis	BEFREE	8659493		★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	12471298, 15364762, 17987391, 21393362, 21525147, 23603420, 25683681, 26436397		★☆☆☆☆ Found in Text Mining only
High altitude pulmonary hypertension	High altitude pulmonary edema	BEFREE	12406857, 18578644		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10493570, 10629150, 15670287, 16791616, 19142023, 28186543		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18020099	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	10493570, 15670287, 16772714, 16791616, 19142023, 23922130, 28186543		★☆☆☆☆ Found in Text Mining only
Hydrocephalus, Normal Pressure	Hydrocephalus	BEFREE	10528654, 15729525		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	27206329		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	19602270		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	27709291		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	17243909, 25342476, 25973747, 29081697, 9443774		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	25342476, 32882331	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	24289455, 8739332		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	16830877		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	10082486, 10874503, 12658909, 16186399, 18670619, 21844127, 27951589, 9676990		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	11085286, 28514598		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	LHGDN	17275478		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	20138007, 25154650, 8642232		★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	24193727	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	11387483, 14502296, 24391037		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	24289455, 8739332		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIb	Hyperlipoproteinemia	BEFREE	9603531		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	17142213		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	28808443		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	11665795, 12205735	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	10487323, 10487325, 10888379, 11409653, 11728946, 12135330, 12484507, 12628714, 12675870, 15012913, 15080371, 15097233, 15543563, 15964916, 16088850, 16385653, 16509973, 17298481, 17334527, 17672913, 18550936, 18647135, 18698212, 18758497, 18946466, 19119484, 19126660, 19126661, 19369957, 21063039, 21248783, 21421653, 21436208, 22136292, 22144991, 22245237, 22419662, 22456784, 22723444, 22808171, 23042814, 23741507, 24015270, 24098401, 24150610, 24354906, 24505095, 25000107, 25002132, 25357227, 26297704, 26440392, 26491214, 27030424, 27050505, 27748299, 27754586, 27858843, 28834200, 29058472, 29939946, 30226856, 30804141, 30875817, 32348166, 32519825, 32882331, 32901433, 33676010, 34156316, 34359878, 34489863, 34747787, 36011305, 36355860, 37200278, 37432962, 37667339, 40090707, 40127414, 8083349, 8541160, 9034402, 9264004, 9605383, 9607207, 9708474	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	29923443, 31484569	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Diastolic Resistance to	Resistant hypertension	Pubtator	17487825	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Malignant	Malignant hypertension	Pubtator	10855732, 15655381	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	12692750, 12832683, 16936432, 19592460	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension, Renovascular	Hypertension	BEFREE	10701811, 15326089, 28621587, 28929450, 30950337		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10215283, 10221352, 10335726, 10453099, 10487325, 10488952, 10551431, 10560791, 10608470, 10637201, 10642347, 10642351, 10675799, 10678281, 10720581, 10790347, 10821349, 10829100, 10904004, 10981126, 10983692, 10997795, 11018802, 11029323, 11054622, 11071585, 11081774, 11097339, 11116113, 11128865, 11134677, 11204304, 11231997, 11246471, 11248758, 11330874, 11354781, 11378837, 11387483, 11409653, 11443163, 11518842, 11544438, 11687736, 11694220, 11699055, 11711524, 11727501, 11740395, 11888948, 11897210, 11926202, 11985486, 12005216, 12010139, 12015366, 12023681, 12032106, 12076180, 12126783, 12135330, 12396747, 12444540, 12469902, 12473016, 12511523, 12522467, 12554058, 12675870, 12692750, 12700890, 12743791, 12832683, 12832741, 12885793, 12938141, 1338766, 14504630, 14504631, 14600431, 14609609, 14610337, 14617263, 14682408, 14688494, 14751812, 15012913, 15017542, 15076153, 15076189, 15080371, 15097233, 15106809, 15202514, 15233837, 15338012, 15364762, 15447944, 15543563, 15545843, 15614025, 15642127, 15761539, 15797740, 15861031, 15919834, 15923814, 15984009, 16009403, 16013021, 16047566, 16052407, 16121979, 16176418, 16314202, 16356784, 16419644, 16449550, 16509973, 16612256, 16685579, 16876684, 16877959, 16889537, 16909931, 16936432, 16981142, 17000927, 17196575, 17261659, 17270528, 17283861, 17303661, 17351369, 17473847, 17478487, 17520798, 17579251, 17672913, 17885551, 17898539, 17927479, 18022600, 18049108, 18154415, 18497458, 18516470, 18550936, 18637188, 18647135, 18718603, 18758497, 18832826, 18946466, 19067187, 19082699, 19119484, 19125277, 19126660, 19126661, 19130799, 19145983, 19307186, 19341158, 19355890, 19369957, 19379721, 19443911, 19482546, 19552566, 19596363, 19680137, 19684612, 19706421, 19744011, 19811356, 20065889, 20066004, 20088829, 20093180, 20099993, 20580725, 20639399, 20939740, 21053180, 21076147, 21157371, 21305316, 21342026, 21346373, 21421653, 21436208, 21444836, 21528810, 21614448, 21628354, 21647824, 21955693, 21984781, 21993363, 21993364, 22072187, 22082670, 22103580, 22136292, 22183487, 22223701, 22245237, 22258027, 22456346, 22456784, 22647781, 22739771, 22808171, 23042814, 23077078, 23139134, 23153326, 23330688, 23371888, 23469169, 23540412, 23561051, 23579966, 23598646, 23730990, 23741507, 23891037, 23973719, 24014829, 24015270, 24057178, 24098401, 24271410, 24354906, 24498151, 24505095, 24525789, 24562335, 24622918, 24678643, 24811208, 25000107, 25002132, 25055800, 25342476, 25357227, 25653060, 25743267, 25957879, 25961019, 26000752, 26084817, 26111150, 26222001, 26440392, 26463100, 26491214, 26529791, 26579574, 26741142, 26791477, 26861937, 27030424, 27219718, 27473864, 27546817, 27704319, 27748299, 27844290, 27885499, 27889958, 27943628, 27988209, 28053783, 28096099, 28098801, 28102435, 28158298, 28207279, 28303511, 28315445, 28321677, 28325781, 28333109, 28346238, 28411317, 28416734, 28446809, 28456777, 28460637, 28512108, 28515190, 28537781, 28556182, 28575882, 28626916, 28712707, 28745786, 28752275, 28755451, 28756578, 28791512, 28802945, 28816537, 28831241, 28834200, 28836189, 28847993, 28849507, 28873724, 28910674, 28911306, 28929319, 28929450, 28989072, 29027816, 29032034, 29050316, 29058472, 29081697, 29094913, 29119585, 29141503, 29157802, 29190580, 29196825, 29199539, 29206156, 29240784, 29244531, 29251761, 29271523, 29277755, 29388355, 29389738, 29501845, 29521003, 29548858, 29572755, 29598869, 29602404, 29637415, 29704920, 29725982, 29750228, 29765306, 29766272, 29792847, 29808707, 29849899, 29853750, 29886242, 29908131, 29923443, 29929485, 29933079, 29939946, 29967035, 29990624, 30058413, 30058488, 30062958, 30067536, 30075570, 30078019, 30112656, 30113526, 30140748, 30183974, 30206615, 30208601, 30256890, 30262795, 30283782, 30383807, 30396392, 30402961, 30406296, 30413906, 30481537, 30498455, 30518809, 30518985, 30535909, 30544795, 30581531, 30591990, 30594849, 30599943, 30601319, 30624528, 30631160, 30637771, 30641607, 30691489, 30694931, 30747487, 30763326, 30804141, 30836591, 30836981, 30843458, 30863432, 30868473, 30875817, 30889487, 30898362, 30916008, 30919249, 30919768, 31028794, 31063551, 31064975, 31072831, 31084594, 31114496, 31142441, 31163098, 31177207, 31214554, 31214611, 31237120, 31261199, 31268531, 31272959, 31273339, 31296503, 31319000, 31336853, 31337127, 31340960, 31353484, 31353494, 31384418, 31398788, 31430320, 31441902, 31443094, 31484569, 31489273, 31498767, 31537750, 31539010, 31608485, 31668726, 31700727, 31715212, 31728766, 31746626, 31750488, 31793908, 31802381, 31839907, 31843319, 7508068, 7549432, 7583453, 7586334, 7700002, 7783537, 7807499, 7820539, 7850408, 7882586, 7898096, 7955173, 7986468, 8083382, 8104754, 8292044, 8384602, 8390500, 8391942, 8391946, 8523387, 8529313, 8583476, 8677872, 8733034, 8784123, 8806984, 8822230, 8869131, 8869132, 8872813, 8952598, 8989734, 9034402, 9049480, 9137889, 9140789, 9140790, 9140797, 9160768, 9170002, 9234834, 9257079, 9321743, 9322809, 9352153, 9358012, 9364280, 9428619, 9433518, 9495662, 9524054, 9533415, 9544854, 9589251, 9591915, 9603529, 9605383, 9607207, 9626985, 9654602, 9667803, 9711445, 9794739, 9797175, 9832341, 9870486, 9886871		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	11903319, 12023681, 12133420, 12169209, 12297007, 12511523, 12669427, 15076153, 15076189, 15097233, 15295612, 15545843, 15642127, 15797740, 15869784, 16612256, 16889537, 16981142, 17190732, 17205958, 17283861, 17303661, 17351369, 17448297, 17487825, 17520798, 18260877, 18383374, 18393230, 18497458, 18516470, 18767410, 19112833		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	15773232, 20237592, 27847271		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	14688494, 23803592, 9081678		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	2919610		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	12166654, 15314809, 16087648, 18037749, 18165925, 19390744, 20179607, 20478904, 20975235, 23691019, 24204726, 25476756, 28120210, 29310338, 29371376, 7484741, 7671365, 7788945, 7994801, 8105312, 8759823, 9327710, 9822439		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	LHGDN	15314809, 18165925		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	15314809, 18165925, 19390744, 20179607, 20478904, 23691019, 24204726, 29310338, 7484741, 7671365, 7994801, 8105312, 8759823, 9327710		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	10888379, 30694603, 7759715	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	10888379, 10916115, 10941550, 12628714, 12675870, 12906984, 15788353, 16222898, 26336879, 28513230, 31064975, 40090707, 8177269, 8598840, 8752809, 9014990, 9083287, 9607207	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	11418149, 12637987, 16981144, 20546161, 27951589, 31489273		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	LHGDN	12547848, 16981144		★☆☆☆☆ Found in Text Mining only
Hypopituitarism	Hypopituitarism	Pubtator	27425780	Associate	★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic Left Heart Syndrome	BEFREE	30019493		★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	18433037	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypotension	Hypotension	Pubtator	22136292	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	BEFREE	31396276		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15819995	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	22033511		★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	16208534, 16645262, 17199794, 20418353, 21611163, 21946394, 25997642, 26154535		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	12692750, 29468936, 29752040, 30466619, 30747487, 31599367		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23657604, 29202450		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	12692750, 29468936		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	10100072, 10193250, 10352195, 10391670, 10404693, 10714086, 10752761, 10793025, 10821348, 10977777, 11014979, 11053482, 11354780, 11473656, 11783599, 12119485, 12172761, 12885793, 12911556, 14648325, 15031629, 15153745, 15481848, 15504143, 17124384, 17162429, 17338425, 19037561, 19546528, 19937361, 20689326, 21163122, 21357308, 22173253, 23060471, 24157068, 24452035, 25763757, 28395659, 30270542, 31700813, 7593601, 7791440, 8529313, 9259580, 9590186, 9594210		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	17124384, 17162429		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA Glomerulonephritis	Glomerulonephritis	CTD_human_DG	7593601, 9259580		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	BEFREE	10549798, 10794851, 12006218, 12925557, 15465635, 20121884, 20606435, 20639003, 22348891, 24792094, 24863667, 27608957, 28143626, 28436744, 28449585, 28511735, 28865943, 28870562, 29991133, 30185634, 30389580, 30554134, 30909218, 31378643, 8916108		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	20870476, 26685718, 28376078		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11569699, 17111197, 17713861, 18049167, 31409604		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17713861		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	17264090		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	10487323, 20170341, 22419662, 23461768	Associate	★☆☆☆☆ Found in Text Mining only
Internal Carotid Artery Stenosis	Internal Carotid Artery Stenosis	BEFREE	11941276		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	29457309		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	10882751, 16121979, 21709586, 23847294, 23860151, 9785588		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	23847294	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	12692750	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31409604		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	15151696, 29570216, 30038875, 8105309		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	10354208, 11596779, 15007267, 15277638, 15595935, 16442232, 16443328, 16446094, 16775386, 16787209, 17022779, 17922891, 18027070, 18387982, 18511872, 18586276, 20402757, 21421656, 22800767, 23049705, 23540412, 24620983, 25015258, 25082780, 26187788, 26345891, 26710338, 27468663, 27629735, 29199539, 29228591, 29848495, 29853909, 30219484, 30554134, 30782930, 31013014, 8620347, 8653866, 8903617, 9242959, 9489536		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	34747787, 37204128	Associate	★☆☆☆☆ Found in Text Mining only
Keratosis Follicularis	Keratosis Follicularis	BEFREE	15485441, 15542286, 17142213, 17367703, 17969487, 19142023, 20606435, 24452035		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	10029557, 10073605, 10082486, 10099885, 10100072, 10202997, 10328464, 10332539, 10391391, 10499884, 10516341, 10551431, 10616844, 10619438, 10620209, 10651217, 10773756, 10862639, 10971153, 10983692, 11106834, 11128428, 11143997, 11181802, 11313676, 11381371, 11422735, 11431175, 11522715, 11694220, 11723093, 11917060, 12032106, 12147786, 12148094, 12449516, 12555944, 12571380, 12873298, 14610337, 14688494, 14986085, 15012717, 15016346, 15338496, 15793268, 16044138, 16178979, 16336578, 16362156, 16928730, 16936219, 16960460, 17429318, 17616353, 17885551, 18199798, 18413162, 18550651, 18679781, 19034303, 19108684, 19207872, 19290794, 19696696, 19787680, 20061926, 20540812, 20565247, 20853144, 20854388, 21052031, 21421653, 22017506, 22072187, 22201679, 22554825, 24737640, 25587546, 26111150, 26311058, 27704256, 28064508, 28364692, 28395659, 28482281, 28541811, 28618426, 28619367, 28816537, 28853699, 28862933, 29101168, 29764624, 30296880, 30633770, 30793466, 30992195, 31307778, 31407377, 31472818, 7477652, 7485124, 7555560, 7556981, 7729604, 7804756, 8314010, 8538349, 8573745, 8596493, 8720609, 8749698, 8806248, 8854649, 8901844, 8941475, 8979005, 8995725, 9049480, 9081678, 9084972, 9146976, 9257079, 9350677, 9469501, 9488209, 9519756, 9544854, 9594210, 9617555, 9661139, 9710341, 9726242, 9727375, 9730698, 9794558, 9808093, 9830503, 9844142, 9870486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	10620209, 10682664, 10983692, 11422735, 12449516, 15793268, 16221224, 17601378, 19021774, 20540812, 21421653, 22017506, 24241364, 9509566, 9607207	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	CTD_human_DG	8642790		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	BEFREE	10202997, 10364706, 10430974, 10727542, 11867951, 11881130, 12832734, 14600431, 14688494, 15284309, 15662219, 16002416, 16172283, 16935894, 20061926, 22017489, 24262794, 27190345, 27287265, 27748299, 28008457, 28192475, 28490226, 29764624, 8785402, 8901844, 9350677, 9594210		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	CTD_human_DG	9259580		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure Chronic	Kidney failure	Pubtator	10916074, 11422735, 11918733, 12675870, 16385653, 16525944, 17601378, 18199798, 21421653, 23477970, 24977181, 26440392, 9291178	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	11793101, 19020433, 27147280, 27706879, 28298367, 28341094, 28406186, 28426743, 28460637, 28860786, 28927644, 29116624, 29128438, 29488059, 29489021, 29665445, 29766216, 29908974, 29984818, 30275365, 30422153, 30423160, 30554115, 30949984, 30973904, 31261199, 31619367, 31753901		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	10099885, 10328464, 10430974, 10616844, 10620209, 10773756, 10831637, 10916074, 10983692, 11136175, 11200871, 11354781, 11422735, 11525534, 11544438, 11733623, 11918733, 11961010, 11979350, 12119485, 12172761, 12396747, 12675870, 12697976, 12728975, 12832734, 13679477, 14579936, 14600431, 14686639, 15012717, 15036826, 15045574, 15946912, 16006956, 16105049, 16215641, 16385653, 16525944, 16791616, 16960460, 17199794, 17303584, 17429318, 17601378, 18629615, 19076285, 19288324, 21092187, 21163122, 21421653, 22173253, 22385293, 22903660, 23060471, 23166630, 23477970, 24988067, 26995302, 27050505, 27633502, 28177196, 28279964, 28353612, 29208203, 29498216, 29794446, 29808610, 29982608, 30078019, 30128941, 30343892, 30840289, 31407377, 7593601, 8785402, 9259580, 9291178, 9434071, 9590186, 9820440		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	10099885, 7593601		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	16105049, 16385653		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	10682664	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	27801393, 36860147	Associate	★☆☆☆☆ Found in Text Mining only
Left Bundle-Branch Block	Left Bundle-Branch Block	BEFREE	30676480		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	10215283, 10335726, 10532509, 10536704, 10646957, 10657713, 10673731, 10678281, 10821136, 10822320, 10844381, 10916115, 10918550, 10937920, 10941550, 11134677, 11208681, 11688760, 11768721, 12601259, 12628714, 12675870, 12906984, 12911874, 14600431, 14652492, 15301563, 15314809, 15788353, 15799176, 16138565, 16312263, 17054027, 17460369, 17903694, 19997001, 20065889, 20179607, 22773337, 23077078, 26336879, 26861937, 28513230, 29970016, 30112041, 31064975, 7671365, 7758176, 7820539, 7841088, 7994801, 8076423, 8177269, 8582095, 8583476, 8598840, 8752809, 8800593, 8869131, 8986921, 8989733, 9014990, 9083287, 9197423, 9227291, 9358012, 9364280, 9433518, 9607207, 9626985, 9690230, 9711445, 9717047, 9717855, 9820440, 9822439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	LHGDN	11768721, 12133420, 16136003, 16138565, 17460369, 19112833		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	CTD_human_DG	8349331		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	12742294, 25036270, 28602365, 28820057, 30658628, 7585774		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	18586661		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12186695		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12781647, 31847529		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18807213	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	14662338		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16753875, 30039426		★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	15610555		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	17270454, 24521289		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	17851834, 22776130, 24023347		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	29169723, 31177207		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12677092, 21188521, 23570557, 24391821, 25208933, 25354682, 29163965, 29631561, 29972254, 30008842, 30854929, 31171895		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14767532		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	16328049		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	12554626, 15743363, 19440063, 29085215, 30236768, 31687012		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	19119484, 25208933, 26681055	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	11707686		★☆☆☆☆ Found in Text Mining only
Liver cyst	Liver Cyst	BEFREE	9180368		★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	17186976	Associate	★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	18364271	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	11463587, 18713090, 21960125, 29559844, 30377258, 9441131		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	15798469, 21960125, 35305693	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	CTD_human_DG	18702808		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases Interstitial	Lung disease	Pubtator	8736208	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18156303		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	21552421		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	31877149	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	11071585, 15934435, 20540812, 30760894, 9863894		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20540812, 23448612	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	11071585, 15934435, 20540812, 30760894, 9863894		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10544843, 11071585, 11377823, 12043886, 12215901, 15338496, 15789057, 15934435, 16583472, 16830877, 17631741, 17937470, 20540812, 21976404, 22337243, 22576914, 22729880, 23047029, 26200015, 27956582, 29205894, 30094750, 30618805, 30621494, 30760894, 31529686, 9710341, 9863894		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17631741, 18711292		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	10099886, 12043886, 12215901, 15338496, 15789057, 16047641, 16583472, 16830877, 17631741, 21976404, 22337243, 23047029, 23137230, 25957879, 26200015, 27956582, 29205894		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	12043886		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	11071585, 15934435, 20540812, 30760894, 9863894		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	16474096, 30843885		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16435992, 18059164, 27801393, 29032382, 36860147	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	17525278		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	Pubtator	18020099	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10629150		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	10629150		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	28279837		★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	30849344		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	11027844		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	11027844		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	11027844		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	11027844		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	11027844		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	11027844		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	11027844		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	11920854, 12203048, 12476328, 12633893, 16924268, 19713413, 22036796, 22688325, 22808171, 23157339, 27639288		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	22688325, 22808171		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	28871813, 29457309		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	29789916		★☆☆☆☆ Found in Text Mining only
Malignant Hypertension	Malignant Hypertension	BEFREE	10855732, 15655381, 9797175		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12566298, 14583500, 15498791, 15802301, 16172223, 17023764, 17850737, 19286759, 20945417, 21109584, 21546404, 21638051, 23317229, 23700157, 24055489, 24961504, 25077884, 28186527, 28537988, 28577685, 28807926, 29202630, 29413755, 30235730, 31217631, 31642813		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	15527901, 27956412		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	15798469		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	20438364		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	25990649		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	10682664		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	27801393		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11361058, 20303010, 22339037, 22538550, 25092717, 25354524, 25605160, 27100959, 29937931, 30355745, 31844581, 9441131		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	17851834, 22776130, 24023347		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22571796		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21654174		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14991898, 17465223, 18181094, 20026870, 21874567, 22667764, 24691970, 26940014, 29514670, 29970692, 29992622, 31695843		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17465223		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	27943160		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15814629, 16435992, 17035401, 21864388, 22114933, 25154002, 25990649		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	18059164		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31847529		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15527901, 15806540, 16679861, 17898867, 18181094, 18184167, 18204284, 18210757, 19286759, 20438364, 20733496, 21109584, 21395549, 21477733, 22151803, 22188725, 22667764, 22776130, 23046445, 24691970, 25208933, 25337282, 25990649, 26600487, 27328622, 28416734, 28593789, 29277755, 29413755, 29534876, 29578208, 30377258, 30528285, 30552822, 30682424, 30840967, 30878563, 31019533, 31101682, 31177207, 31234813, 31478246, 31519556, 31721381		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	20482751		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17545615		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	25416682, 28174354, 28779634		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17023764		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21801068		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	31699438		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	16369102		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17525278, 27943160, 27992423, 28905299, 30670595		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	24157068		★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	20085788		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	15010349, 15949885, 16924268, 19439995, 19918760, 20639003, 22348891, 22688325, 22808171, 23157339, 24193727, 27264499, 27639288, 28127518, 28760142, 28982269, 29132028, 30554134, 30898617, 31005595, 8641725		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	11920854, 12458570, 16236416, 18986708, 20010451, 25189904, 28641333, 28865943		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28712073, 30641607		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	29058472	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20305326, 26910623	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	11213892, 11427204, 12032106, 17603286, 17673929, 18154415, 18205097, 19800705, 20816596, 21330420, 21362306, 22168210, 22209668, 23215737, 23685945, 24200052, 26483160, 27417115, 28442252, 28504003, 29106817, 30385846, 8521557, 9591757		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	LHGDN	14959477		★☆☆☆☆ Found in Text Mining only
Microangiopathy, Diabetic	Diabetic cardiomyopathy	BEFREE	9498629		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcolon	Microcolon	BEFREE	30071301		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular Angina	BEFREE	8623746		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	10765051, 15644278, 15893594, 17381556, 18366776, 19081115, 19221299, 19298544, 19673907, 19925624, 23278516, 24444405, 25115162, 26000817, 27483173, 31515634		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	LHGDN	17123735		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	12811592, 15644278, 19221299, 19673907, 23278516, 24444405, 27255917		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	LHGDN	15644278		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	20085788, 21108975, 22405893, 26159191, 26976043, 28143626, 28269787, 28870562, 29393151, 30425636, 30987514		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	14585904, 19821806, 20134171, 20450391, 21795738, 23850180		★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	12514670, 17379330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	LHGDN	12514670		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	28127518, 30196829		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	11121171, 11145009, 16924268, 19409959, 19475602, 30328224, 8931914		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	15164145, 15295089, 16614502, 22277255, 9128808		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	15295089, 16614502		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	16614502	Associate	★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic renal dysplasia	BEFREE	27206329		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	26084817		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30788288		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17083336, 20541774, 21320707, 21699406, 27000216, 27568030, 28127518, 28430710, 30196829, 30218954, 31828731		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	28127518	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	29292032		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Emery Dreifuss	Emery dreifuss muscular dystrophy	Pubtator	35011591	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	16950195, 27462804, 28432191, 29067654, 30448404, 30564867, 30573480, 31077250, 31388039		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30861111		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19761684		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	25955555		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	BEFREE	14767579		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	18586661		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10328464, 10334805, 10371375, 10435047, 10454299, 10462466, 10486698, 10488956, 10554703, 10592684, 10615414, 10642324, 10669647, 10678281, 10731400, 10794598, 10818534, 10841123, 10938484, 11043512, 11054622, 11106322, 11116112, 11122322, 11137090, 11208361, 11256587, 11257269, 11286523, 11330506, 11427204, 11787479, 11903350, 11994975, 12005216, 12102452, 12444540, 12628714, 12676177, 12676179, 12748347, 12791034, 12826927, 1328889, 14643574, 15026870, 15119966, 15150438, 15193812, 15277998, 15320825, 15367486, 15635071, 15671045, 16288777, 16420563, 16765625, 17094051, 17235107, 17299437, 17522061, 17579251, 18347611, 18445609, 19502257, 19552566, 19596363, 19744011, 20230274, 20529973, 20730398, 21148050, 21163865, 21955693, 22456784, 22679279, 23566835, 26214489, 26588586, 26687160, 26985916, 27865662, 28166592, 28339659, 28575882, 28577679, 28645882, 28982370, 29033508, 29216228, 29496021, 29522561, 29544929, 29598869, 29859479, 30130974, 30465493, 30599150, 30738210, 30788675, 30948834, 30974387, 31371116, 7549432, 7554183, 7555560, 7585774, 7586243, 7589881, 7614074, 7631331, 7634441, 7639154, 7697839, 7700002, 7723497, 7737732, 7759715, 7764464, 7783537, 7807499, 7840807, 7850408, 7850980, 7854377, 7882471, 7898088, 7898096, 7909524, 7913911, 7934345, 7955173, 7986468, 7988087, 7990100, 7994801, 8044936, 8083349, 8096947, 8105309, 8131299, 8131300, 8170965, 8391942, 8536956, 8548410, 8583476, 8644984, 8653866, 8675669, 8677859, 8677872, 8713489, 8743524, 8752809, 8772692, 8793580, 8800107, 8821841, 8842348, 8866203, 8869131, 8903616, 8946109, 9034401, 9115954, 9147898, 9170397, 9180106, 9200271, 9237022, 9247746, 9254851, 9272166, 9273825, 9285181, 9327770, 9358012, 9364295, 9377825, 9520252, 9524054, 9525548, 9561998, 9591757, 9603531, 9693941, 9699903, 9733227, 9796075, 9796837, 9806472, 9812182, 9814614, 9830503, 9857918, 9920524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	10484574, 10794598, 11446493, 11994975, 12628714, 12798565, 15119966, 18445609, 18946466, 19502257, 20230274, 20730398, 21162760, 21330421, 22333273, 22392878, 22456784, 22679279, 22808171, 24806378, 29268798, 37657040, 7759715, 8083349, 8170965, 8541160, 8675669, 8752809, 8800107, 9060882, 9180106, 9364295, 9377825, 9525548, 9561998	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	12360613, 12898814, 15193812, 17429286, 17598398		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	1328889, 8131300		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	10435047, 10499884, 10938484, 14500990, 15295089, 16019571, 16614502, 19423314, 19502257, 23572029, 24452036, 27633002, 29141503, 7585774, 7854377, 8582133, 8641725, 9115957, 9170397, 9180106, 9237022, 9443775, 9498629, 9693941, 9699903, 9825196		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	16614502, 7854377, 9180106, 9825196	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial necrosis	Myocardial necrosis	BEFREE	28645882		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	31673885		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	31388039		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	14599112, 34889890	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	11770799		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22064901, 31737097		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	16146753		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10450835, 15527901, 15814629, 17023764, 17525278, 17548686, 17898867, 21188521, 21477733, 22048948, 22188725, 22776130, 25208933, 25735342, 26940014, 27956412, 28809959, 29277755, 29413755, 29534876, 29972254, 30071515, 30253020, 30429019, 30528285, 30596895, 30670595, 30963680, 31252299, 31528333, 31615657, 31624895, 31642813, 8467320, 9140790		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	11071585, 12215901, 25957879, 26200015, 30191985, 30879080		★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	10916074, 28785983, 28785985		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	10916074, 28785983, 28785985		★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	BEFREE	10528654		★☆☆☆☆ Found in Text Mining only
Nephronophthisis 1	Nephronophthisis	BEFREE	10528654		★☆☆☆☆ Found in Text Mining only
Nephronophthisis 3	Nephronophthisis	Pubtator	31922211	Associate	★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	BEFREE	8989734		★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	16421456	Associate	★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	16421456, 22017506	Associate	★☆☆☆☆ Found in Text Mining only
Nephrosis, congenital	Nephrosis, Congenital	BEFREE	16703378		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	14610337, 16208534, 16645262, 17199794		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	16421456, 16525944, 20418353	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	16525944, 16550752, 16825089, 20195644, 31749142, 9434071		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	16208534, 16645262, 17199794, 20418353, 21611163, 21946394, 22017506, 25997642, 26154535, 9434071		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	10681079, 30196829		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	12858018, 21833743, 28626916, 28828974		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	29486514, 31388039		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	20541774		★☆☆☆☆ Found in Text Mining only
Neuropathy, Painful	Neuropathy	BEFREE	31109280		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	29764603		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28515091		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	10099885, 10857950, 23733546, 7909524		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	BEFREE	10857950, 26973293		★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Berger disease	Berger Disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29452601, 29636553		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	31198195		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18156303, 23334061, 27328622		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonarteritic anterior ischemic optic neuropathy (NAION)	Nonarteritic Anterior Ischemic Optic Neuropathy	BEFREE	10964835, 23401650		★☆☆☆☆ Found in Text Mining only
Noncompaction cardiomyopathy	Noncompaction cardiomyopathy	BEFREE	22883165		★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	22033511		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10642320, 12559614, 15076153, 15367486, 15520830, 15912101, 15919834, 17016614, 17164796, 17520798, 17624939, 18294050, 18591916, 18637188, 19125277, 19680237, 19857036, 20070157, 20122911, 20816596, 21614448, 21779803, 22880127, 23398920, 23745680, 24076353, 24150609, 24200052, 25416682, 25768006, 26491214, 28096099, 28115791, 28315876, 28615046, 28965093, 29106817, 29115082, 29435690, 29546999, 30098343, 30274353, 30416093, 31084908, 31197649, 8391942, 8723984, 9140797, 9654602		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	12898464, 15919834, 16088850, 16222048, 18046090, 19680237, 22880127, 23042814, 26491214, 28096099, 29546999, 32121233, 32356512, 32398726	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29115082	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	17164796, 25416682		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	15462112, 20305326, 27812677, 35190362, 9607207	Associate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	23661462	Stimulate	★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	29885298		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	30760894		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	11250978, 21633717	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	23089924, 25178458, 26261641	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	25178458	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	12858018, 18565253, 30765613		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29080997, 30423288, 31500447, 31624895		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29122669, 30311344, 31177207		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	33499313	Associate	★☆☆☆☆ Found in Text Mining only
Otosclerosis	Otosclerosis	BEFREE	18491423		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	9156148	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	23615648		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22571796		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21654174		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	19212105		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	25070351, 29138810		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	28441432		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	19307975, 21654174		★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	BEFREE	20146651		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	15158002, 20146651, 22353325, 25189904, 28554847		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	22353325	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	28809959		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31847529		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10023114, 11015454, 12084438, 17196621, 18805557, 23833036, 25143327, 28320196, 28836869, 28873462, 29392456, 30868473		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	11015454	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	17196621		★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	15331425		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	16146753		★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	11715070		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	30238580		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	17035401, 20824505, 26369686		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	29267626		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	25555251		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	19782519, 22144991	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	12143941, 12208484, 19782519, 20478683, 28627932, 28816530, 28816537, 30874413, 31626938		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	28816530, 28816537		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	16949519, 28373993		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	16949519, 28373993		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	LHGDN	16949519		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	12143941, 12208484, 12419932, 14632699, 17611909, 19782519, 20478683, 21955693		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	LHGDN	17611909		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	26084817		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	10369426, 11399938, 12586176, 18541327		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	24101265	Associate	★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	BEFREE	31451467		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	17985406		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	27748299	Associate	★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	9291178		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	11136175		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	9291178	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	10430974, 10477143, 10831637, 10983692, 11142763, 11733623, 12697976, 13679477, 14600431, 16935894, 26482465, 27748299, 28332417, 9180368, 9291178, 9442442		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	LHGDN	17205958		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	19602270, 19636212, 20138007, 20170341, 21939743, 22223701, 22791704, 23232975, 27840997, 31593246, 31814467		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	20170341, 23461768, 31814467	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	36856520	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycythemia Vera	Polycythemia Vera	BEFREE	16372584, 25955555		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	36856520	Associate	★☆☆☆☆ Found in Text Mining only
Polyneuropathies	Polyneuropathy	Pubtator	12449516	Associate	★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	12449516		★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	12554626, 15743363, 19440063, 28565796, 30236768		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	25921615, 29731118, 31063551		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	23499421		★☆☆☆☆ Found in Text Mining only
PREMATURE OVARIAN FAILURE 10	Premature Ovarian Failure	BEFREE	28408160		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	10400221, 10549798, 10818534, 11328206, 11402126, 12634288, 12736093, 16970648, 17270454, 18838196, 19716217, 21533863, 21833743, 26159191, 27038455, 27639288, 28511735, 28657841, 28865943, 29034839, 29081697, 30428833, 30820047, 30991105, 9129727, 9777422		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	10643899, 14872014, 17192785, 30820047, 9916793		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	19119484		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	29971909		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	26159191		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	10480521, 11106834, 11399938, 12586176, 12660488, 19865794		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	28600710		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14991898, 17465223, 18181094, 20026870, 21874567, 22667764, 24691970, 26940014, 29514670, 29970692, 29992622, 31695843		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	20026870	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17465223		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17465223		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17465223, 20026870, 29970692, 34799866	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	10193250, 10620209, 17601378	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	15491418, 17263818, 17489742, 19930490, 23413281, 23621089, 23846034, 24997622, 27460887, 30304544, 31598933		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	17263818, 17489742, 18031458		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	24743863	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	25341451		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	12832683, 16600946, 20156752, 23661462, 23702088	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	26436397	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28207279		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11381371, 11463587, 16044138, 29202450		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyruvate Dehydrogenase Complex Deficiency Disease	Pyruvate Dehydrogenase Complex Deficiency Disease	BEFREE	17487825		★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	12043886		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	31252299		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	23455487		★☆☆☆☆ Found in Text Mining only
Recurrent depression	Mental Depression	BEFREE	11145009		★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	11145009		★☆☆☆☆ Found in Text Mining only
Renal Artery Stenosis	Renal Artery Stenosis	BEFREE	10567188, 14718831, 29908974		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	10682664		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21477733, 28224412, 29098020		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	12471481		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	11756350, 12172761, 19937361, 7593601, 9247746, 9661139, 9710341		★☆☆☆☆ Found in Text Mining only
Renal hypertension	Renal Hypertension	BEFREE	12172317		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	10727542, 11728946, 11881130, 12043886, 12832734, 12885793, 15662219, 16525944, 17710578, 27746281, 27761002, 28008457, 28490226, 29527914, 30109716, 30242588, 31300268, 9594210		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	CTD_human_DG	9259580		★☆☆☆☆ Found in Text Mining only
Renal tubular dysgenesis of genetic origin	Renal Tubular Dysgenesis Of Genetic Origin	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Renal Tubular Dysgenesis With Choanal Atresia And Athelia	Renal Tubular Dysgenesis With Choanal Atresia And Athelia	ORPHANET_DG	16116425, 22095942		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	18702808, 21960125, 23560051, 9441131		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	16146753, 21749216, 22339243, 24796387		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	12204859, 15381116, 15819995, 16146753, 16484896, 17107992, 18060663, 18955615, 20134095, 20515555, 21749216, 22005825, 22339243, 22938636, 23364437, 23635999, 24127120, 24796387, 25869723, 30845246, 31320458		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	LHGDN	17107992		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	16146753, 21749216, 21960125, 22339243, 24796387, 26172140		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	12204859		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	CTD_human_DG	14657821		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	18702808, 23560051, 32882331	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Restrictive cardiomyopathy	Restrictive cardiomyopathy	BEFREE	18165925		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	10480521, 10499884, 11640993, 12449516, 12660488, 12873287, 15019597, 18523141, 21038299, 29378484, 7555560, 8314010, 8587251, 8720609, 8989733, 9258285, 9498629		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	28128370	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	15213845, 23289804, 24569626		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	30849344		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	LHGDN	12169829		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	21038299, 26172140, 30225217		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	15655270, 25719581	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	19847428, 23749169, 25719581, 27758878		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11036822, 17985406, 20401725, 23000565, 23413281, 23981749, 26727555, 29216228, 31785770		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	16926975		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	24150611	Associate	★☆☆☆☆ Found in Text Mining only
Right ventricular failure	Ventricular Failure	BEFREE	26583148		★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	10351920, 10701811		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10207944, 10362030, 10629150, 10672133, 11168787, 11463587, 11886480, 12005216, 12930157, 15332393, 15881283, 16319043, 16901684, 17138677, 17543165, 17768594, 18049432, 18496980, 18514098, 19070256, 19119484, 19259660, 20560294, 21319597, 23281417, 23676252, 23897103, 24696153, 24814734, 25966127, 26847094, 28132132, 28295528, 28345954, 29121154, 29425104, 29726829, 29929412, 30053466, 30101857, 30154391, 30632406, 30658987, 30760894, 30888491, 31192941, 31300268, 31622413, 31672631, 8564143, 8795663, 9230757, 940508, 9657660, 9713444, 9726736, 9817709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	10362030, 10672133, 11168787, 16901684, 17138677, 19119484, 20066543, 23030744, 34325227, 35395284, 36893477, 39393304, 8795663, 9713444	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	LHGDN	17768594, 18049432, 18496980		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	8736208	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	11408790, 11920854, 12707930, 12729939, 15978554, 18986708, 19508883, 20010451, 21158679, 24615782, 25143327, 25694211, 25701466, 26296754, 28028641, 29032706, 29925475, 30045724, 30321766, 30806143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	12707930, 18986708		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20010451, 21158679, 24615782, 25694211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24743863, 33688928, 35606706	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia and related disorders	Schizophrenia	BEFREE	18986708		★☆☆☆☆ Found in Text Mining only
Scleritis	Scleritis	BEFREE	30951689		★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	12459519, 9145540		★☆☆☆☆ Found in Text Mining only
Secondary hypothyroidism	Hypothyroidism	BEFREE	30450996		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	26234235, 31006710	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	31006710		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	20625269		★☆☆☆☆ Found in Text Mining only
Separation Anxiety Disorder	Separation Anxiety Disorder	BEFREE	28488289		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	15549142, 16146753, 18060663, 23748624, 25400733, 30303835, 31135703, 31733315		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	CTD_human_DG	15381116		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	15819995, 17504232		★☆☆☆☆ Found in Text Mining only
Sexual Dysfunction	Sexual Dysfunction	BEFREE	31113742		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	28336767		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	24203630	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	24203630		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	11401071, 18763423, 23609427, 31064975	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	11401071, 15447944, 17520798		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	11401071, 23609427	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	11016793, 11401071, 11601275, 17351369, 17520798, 19482546, 20182789, 20449805, 22183487, 23359027, 23371888, 24271410, 25917830, 26486181, 29094873, 31064975		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea, Obstructive	Sleep Apnea	LHGDN	17520798		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Disorders	Sleep Disorders	BEFREE	29859479		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28416734		★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	31529686		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	17875181	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	22876137	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22339037, 24203630, 27943160, 28814250, 31780113		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33513805	Associate	★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	19664801, 21162760, 29141503, 30301543, 30470725, 30632033, 30785928, 31195108, 31491742, 31647035		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	12911874, 14583365, 29522561		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21664615		★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	16825089, 21611163, 21787164		★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	14986085, 21611163, 21946393		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15814629, 16435992, 17035401, 21864388, 22114933, 25154002, 25990649		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15814629, 17548686		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	15897638, 16435992, 18059164	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	18059164		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	35305614	Associate	★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	20870476, 26685718, 28376078		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	18387982, 21421656, 34747787	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	15166392, 16121979, 21709586, 25653060, 28106497, 30544795, 31430320		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	28336767		★☆☆☆☆ Found in Text Mining only
Symmetrical dyschromatosis of extremities	Symmetrical Dyschromatosis Of Extremities	BEFREE	11791024		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	28336767		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	12015245, 15016346, 16614523, 16855131, 17264090, 19132786, 22173230, 25299202, 28008457, 30747487, 30936287		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	12015245, 17264090		★☆☆☆☆ Found in Text Mining only
Tachycardia Ventricular	Ventricular tachycardia	Pubtator	19126662	Associate	★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	30038875, 30074111, 30302762		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	21740877		★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic disease	Pubtator	23334061	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	25955555		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	11054622, 19833623, 27729560, 9708474		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	24569626, 34441050, 9708474	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia, hereditary	Thrombophilia	BEFREE	12719783		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	34441050	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31847529		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31847529		★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	BEFREE	29916560		★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	12925557, 14990394		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	12925557, 14990394		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	23232975, 31066953		★☆☆☆☆ Found in Text Mining only
Tricuspid Atresia	Tricuspid atresia	Pubtator	15671615	Associate	★☆☆☆☆ Found in Text Mining only
TROPICAL CALCIFIC PANCREATITIS	TROPICAL CALCIFIC PANCREATITIS	BEFREE	17163998		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11569699, 18049167, 31179321		★☆☆☆☆ Found in Text Mining only
Unilateral agenesis of kidney	Renal aplasia	BEFREE	27206329, 8503422		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	11920854, 12476328, 12633893, 16924268, 19713413, 22036796, 22683751, 22688325, 22808171, 27639288		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	22688325, 22808171		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uremia	Uremia	BEFREE	23166630		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	10604520, 18181977, 29850387		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	LHGDN	18181977		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	17186537, 25735342		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	29121154, 30053466, 30442816		★☆☆☆☆ Found in Text Mining only
Uveitis, Posterior	Uveitis	BEFREE	29037906		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	10403609, 10676718, 10701811, 11018310, 11124487, 15010349, 15016346, 16047566, 16855131, 17186537, 17889866, 18629615, 21157371, 21976404, 28353612, 28595700, 28856537, 8610309, 8821841, 9264004		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	15292102, 17889866, 22723444, 23702088, 33499313, 9264004	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	11836444, 27240348	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vasculitis	Vasculitis	BEFREE	22277255		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	34441050	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	11994975	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	10615414, 22939041, 28575882		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	12906984, 16875979, 18046090, 21162760, 22297600, 9083287	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	21248783	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	30038875		★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	BEFREE	10639182, 7495212		★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	10486698, 19648063, 24270863, 25869724, 9180106	Associate	★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	BEFREE	10401028, 10971153, 11519895, 11917060, 12352339, 12471481, 15045574, 15138870, 19603195, 20022049, 22396489, 26717402		★☆☆☆☆ Found in Text Mining only
Vesicoureteral Reflux 1	Vesicoureteral Reflux	BEFREE	10452281, 11409168, 11519895, 12478352, 14764974, 15045574, 15138870, 19288324, 19603195, 22396489, 26717402		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	29079468		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	32901433	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	16044257, 19129082, 21382792, 23278772, 23325447, 23413281, 25807210, 26177100, 29199612		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	26177100	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	16044257, 19129082, 21382792, 23278772, 23325447, 23413281, 25807210, 26177100, 29199612		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	10495473		★☆☆☆☆ Found in Text Mining only