Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	163059
Gene name	Zinc finger protein 433
Gene symbol	ZNF433
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19p13.2

Show/Hide all (11)

miRTarBase ID	miRNA	Experiments
MIRT2378037	hsa-miR-1224-3p	CLIP-seq
MIRT2378038	hsa-miR-1343	CLIP-seq
MIRT2378039	hsa-miR-3545-3p	CLIP-seq
MIRT2378040	hsa-miR-3663-5p	CLIP-seq
MIRT2378041	hsa-miR-378g	CLIP-seq
MIRT2378042	hsa-miR-4274	CLIP-seq
MIRT2378043	hsa-miR-4423-5p	CLIP-seq
MIRT2378044	hsa-miR-4503	CLIP-seq
MIRT2378045	hsa-miR-4635	CLIP-seq
MIRT2378046	hsa-miR-4680-5p	CLIP-seq
MIRT2378047	hsa-miR-4720-3p	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8N7K0

Protein name

Zinc finger protein 433

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	6 → 47	KRAB box	Family
PF00096	zf-C2H2	170 → 192	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	226 → 248	Zinc finger, C2H2 type	Domain
PF13912	zf-C2H2_6	254 → 279		Domain
PF00096	zf-C2H2	282 → 304	Zinc finger, C2H2 type	Domain
PF13894	zf-C2H2_4	310 → 333		Domain
PF00096	zf-C2H2	366 → 388	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	394 → 416	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	422 → 444	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	450 → 472	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	534 → 556	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	562 → 584	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	618 → 640	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	646 → 668	Zinc finger, C2H2 type	Domain

Sequence

MMFQDSVAFEDVAVTFTQEEWALLDPSQKNLCRDVMQETFRNLASIGKKWKPQNIYVEYE
NLRRNLRIVGERLFESKEGHQHGEILTQVPDDMLKKTTTGVKSCESSVYGEVGSAHSSLN
RHIRDDTGHKAYEYQEYGQKPYKCKYCKKPFNCLSSVQTHERAHSGRKLYVCEECGKTFI
SHSNLQRHRIMHRGDGPYKCKFCGKALMFLSLYLIHKRTHTGEKPYQCKQCGKAFSHSSS
LRIHERTHTGEKPYKCNECGKAFHSSTCLHAHKRTHTGEKPYECKQCGKAFSSSHSFQIH
ERTHTGEKPYECKECGKAFKCPSSVRRHERTHSRKKPYECKHCGKVLSYLTSFQNHLGMH
TGEISHKCKICGKAFYSPSSLQTHEKTHTGEKPYKCNQCGKAFNSSSSFRYHERTHTGEK
PYECKQCGKAFRSASLLQTHGRTHTGEKPYACKECGKPFSNFSFFQIHERMHREEKPYEC
KGYGKTFSLPSLFHRHERTHTGGKTYECKQCGRSFNCSSSFRYHGRTHTGEKPYECKQCG
KAFRSASQLQIHGRTHTGEKPYECKQCGKAFGSASHLQMHGRTHTGEKPYECKQCGKSFG
CASRLQMHGRTHTGEKPYKCKQCGKAFGCPSNLRRHGRTHTGEKPYKCNQCGKVFRCSSQ
LQVHGRAHCIDTP

Sequence length

673

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34439859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30774387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20598377		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	20598377		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	20598377		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	30774387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	34439859	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF433 (zinc finger protein 433)