Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	1627
Gene name	Drebrin 1
Gene symbol	DBN1
Synonyms (NCBI Gene)	D0S117E
Chromosome	5
Chromosome location	5q35.3
Summary	The protein encoded by this gene is a cytoplasmic actin-binding protein thought to play a role in the process of neuronal growth. It is a member of the drebrin family of proteins that are developmentally regulated in the brain. A decrease in the amount of

356

Show/Hide all (356)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020934	hsa-miR-155-5p	Proteomics	18668040
MIRT024053	hsa-miR-1-3p	Proteomics	18668040
MIRT024053	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT046733	hsa-miR-222-3p	CLASH	23622248
MIRT045543	hsa-miR-149-5p	CLASH	23622248
MIRT045157	hsa-miR-186-5p	CLASH	23622248
MIRT040871	hsa-miR-18a-3p	CLASH	23622248
MIRT039919	hsa-miR-615-3p	CLASH	23622248
MIRT037119	hsa-miR-877-3p	CLASH	23622248
MIRT558490	hsa-miR-137	HITS-CLIP	21572407
MIRT558488	hsa-miR-4282	HITS-CLIP	21572407
MIRT558489	hsa-miR-10a-3p	HITS-CLIP	21572407
MIRT558486	hsa-miR-4307	HITS-CLIP	21572407
MIRT558487	hsa-miR-4729	HITS-CLIP	21572407
MIRT558485	hsa-miR-4716-5p	HITS-CLIP	21572407
MIRT558484	hsa-miR-4536-3p	HITS-CLIP	21572407
MIRT558478	hsa-miR-517a-3p	HITS-CLIP	21572407
MIRT558477	hsa-miR-517b-3p	HITS-CLIP	21572407
MIRT558476	hsa-miR-517c-3p	HITS-CLIP	21572407
MIRT558473	hsa-miR-5590-5p	HITS-CLIP	21572407
MIRT558474	hsa-miR-4659a-5p	HITS-CLIP	21572407
MIRT558472	hsa-miR-4659b-5p	HITS-CLIP	21572407
MIRT558471	hsa-miR-4776-3p	HITS-CLIP	21572407
MIRT558492	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT558491	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT558490	hsa-miR-137	PAR-CLIP	21572407
MIRT558488	hsa-miR-4282	PAR-CLIP	21572407
MIRT558489	hsa-miR-10a-3p	PAR-CLIP	21572407
MIRT558486	hsa-miR-4307	PAR-CLIP	21572407
MIRT558487	hsa-miR-4729	PAR-CLIP	21572407
MIRT558485	hsa-miR-4716-5p	PAR-CLIP	21572407
MIRT558484	hsa-miR-4536-3p	PAR-CLIP	21572407
MIRT558483	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT558482	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT558481	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT558480	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT558479	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT558478	hsa-miR-517a-3p	PAR-CLIP	21572407
MIRT558477	hsa-miR-517b-3p	PAR-CLIP	21572407
MIRT558476	hsa-miR-517c-3p	PAR-CLIP	21572407
MIRT558475	hsa-miR-548aw	PAR-CLIP	21572407
MIRT558473	hsa-miR-5590-5p	PAR-CLIP	21572407
MIRT558474	hsa-miR-4659a-5p	PAR-CLIP	21572407
MIRT558472	hsa-miR-4659b-5p	PAR-CLIP	21572407
MIRT558471	hsa-miR-4776-3p	PAR-CLIP	21572407
MIRT538201	hsa-miR-483-3p	PAR-CLIP	22012620
MIRT538200	hsa-miR-5195-5p	PAR-CLIP	22012620
MIRT538199	hsa-miR-5193	PAR-CLIP	22012620
MIRT538198	hsa-miR-660-3p	PAR-CLIP	22012620
MIRT538197	hsa-miR-1914-5p	PAR-CLIP	22012620
MIRT538196	hsa-miR-1304-3p	PAR-CLIP	22012620
MIRT538195	hsa-miR-4679	PAR-CLIP	22012620
MIRT538194	hsa-miR-548ao-5p	PAR-CLIP	22012620
MIRT538193	hsa-miR-548ax	PAR-CLIP	22012620
MIRT538192	hsa-miR-5585-5p	PAR-CLIP	22012620
MIRT538191	hsa-miR-4513	PAR-CLIP	22012620
MIRT538190	hsa-miR-6855-3p	PAR-CLIP	22012620
MIRT538189	hsa-miR-6857-3p	PAR-CLIP	22012620
MIRT538188	hsa-miR-653-3p	PAR-CLIP	22012620
MIRT538187	hsa-miR-3136-5p	PAR-CLIP	22012620
MIRT538186	hsa-miR-4439	PAR-CLIP	22012620
MIRT538185	hsa-miR-943	PAR-CLIP	22012620
MIRT538184	hsa-miR-8070	PAR-CLIP	22012620
MIRT538183	hsa-miR-4675	PAR-CLIP	22012620
MIRT558490	hsa-miR-137	HITS-CLIP	21572407
MIRT558488	hsa-miR-4282	HITS-CLIP	21572407
MIRT558489	hsa-miR-10a-3p	HITS-CLIP	21572407
MIRT558486	hsa-miR-4307	HITS-CLIP	21572407
MIRT558487	hsa-miR-4729	HITS-CLIP	21572407
MIRT558485	hsa-miR-4716-5p	HITS-CLIP	21572407
MIRT558484	hsa-miR-4536-3p	HITS-CLIP	21572407
MIRT558478	hsa-miR-517a-3p	HITS-CLIP	21572407
MIRT558477	hsa-miR-517b-3p	HITS-CLIP	21572407
MIRT558476	hsa-miR-517c-3p	HITS-CLIP	21572407
MIRT558473	hsa-miR-5590-5p	HITS-CLIP	21572407
MIRT558474	hsa-miR-4659a-5p	HITS-CLIP	21572407
MIRT558472	hsa-miR-4659b-5p	HITS-CLIP	21572407
MIRT558471	hsa-miR-4776-3p	HITS-CLIP	21572407
MIRT558492	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT558491	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT558490	hsa-miR-137	PAR-CLIP	21572407
MIRT558488	hsa-miR-4282	PAR-CLIP	21572407
MIRT558489	hsa-miR-10a-3p	PAR-CLIP	21572407
MIRT558486	hsa-miR-4307	PAR-CLIP	21572407
MIRT558487	hsa-miR-4729	PAR-CLIP	21572407
MIRT558485	hsa-miR-4716-5p	PAR-CLIP	21572407
MIRT558484	hsa-miR-4536-3p	PAR-CLIP	21572407
MIRT558483	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT558482	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT558481	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT558480	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT558479	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT558478	hsa-miR-517a-3p	PAR-CLIP	21572407
MIRT558477	hsa-miR-517b-3p	PAR-CLIP	21572407
MIRT558476	hsa-miR-517c-3p	PAR-CLIP	21572407
MIRT558475	hsa-miR-548aw	PAR-CLIP	21572407
MIRT558473	hsa-miR-5590-5p	PAR-CLIP	21572407
MIRT558474	hsa-miR-4659a-5p	PAR-CLIP	21572407
MIRT558472	hsa-miR-4659b-5p	PAR-CLIP	21572407
MIRT558471	hsa-miR-4776-3p	PAR-CLIP	21572407
MIRT538201	hsa-miR-483-3p	PAR-CLIP	22012620
MIRT538200	hsa-miR-5195-5p	PAR-CLIP	22012620
MIRT538199	hsa-miR-5193	PAR-CLIP	22012620
MIRT538198	hsa-miR-660-3p	PAR-CLIP	22012620
MIRT538197	hsa-miR-1914-5p	PAR-CLIP	22012620
MIRT538196	hsa-miR-1304-3p	PAR-CLIP	22012620
MIRT538195	hsa-miR-4679	PAR-CLIP	22012620
MIRT538194	hsa-miR-548ao-5p	PAR-CLIP	22012620
MIRT538193	hsa-miR-548ax	PAR-CLIP	22012620
MIRT538192	hsa-miR-5585-5p	PAR-CLIP	22012620
MIRT538191	hsa-miR-4513	PAR-CLIP	22012620
MIRT538190	hsa-miR-6855-3p	PAR-CLIP	22012620
MIRT538189	hsa-miR-6857-3p	PAR-CLIP	22012620
MIRT538188	hsa-miR-653-3p	PAR-CLIP	22012620
MIRT538187	hsa-miR-3136-5p	PAR-CLIP	22012620
MIRT538186	hsa-miR-4439	PAR-CLIP	22012620
MIRT538185	hsa-miR-943	PAR-CLIP	22012620
MIRT538184	hsa-miR-8070	PAR-CLIP	22012620
MIRT538183	hsa-miR-4675	PAR-CLIP	22012620
MIRT923758	hsa-miR-103b	CLIP-seq
MIRT923759	hsa-miR-1203	CLIP-seq
MIRT923760	hsa-miR-1207-3p	CLIP-seq
MIRT923761	hsa-miR-1224-3p	CLIP-seq
MIRT923762	hsa-miR-1260	CLIP-seq
MIRT923763	hsa-miR-1260b	CLIP-seq
MIRT923764	hsa-miR-1275	CLIP-seq
MIRT923765	hsa-miR-1280	CLIP-seq
MIRT923766	hsa-miR-1290	CLIP-seq
MIRT923767	hsa-miR-1291	CLIP-seq
MIRT923768	hsa-miR-129-3p	CLIP-seq
MIRT923769	hsa-miR-146b-3p	CLIP-seq
MIRT923770	hsa-miR-182	CLIP-seq
MIRT923771	hsa-miR-188-3p	CLIP-seq
MIRT923772	hsa-miR-1908	CLIP-seq
MIRT923773	hsa-miR-1915	CLIP-seq
MIRT923774	hsa-miR-1972	CLIP-seq
MIRT923775	hsa-miR-19a	CLIP-seq
MIRT923776	hsa-miR-19b	CLIP-seq
MIRT923777	hsa-miR-2110	CLIP-seq
MIRT923778	hsa-miR-2113	CLIP-seq
MIRT923779	hsa-miR-2355-5p	CLIP-seq
MIRT923780	hsa-miR-2861	CLIP-seq
MIRT923781	hsa-miR-296-5p	CLIP-seq
MIRT923782	hsa-miR-31	CLIP-seq
MIRT923783	hsa-miR-3121-5p	CLIP-seq
MIRT923784	hsa-miR-3123	CLIP-seq
MIRT923785	hsa-miR-3132	CLIP-seq
MIRT923786	hsa-miR-3141	CLIP-seq
MIRT923787	hsa-miR-3145-3p	CLIP-seq
MIRT923788	hsa-miR-3150a-3p	CLIP-seq
MIRT923789	hsa-miR-3154	CLIP-seq
MIRT923790	hsa-miR-3156-3p	CLIP-seq
MIRT923791	hsa-miR-3167	CLIP-seq
MIRT923792	hsa-miR-3173-3p	CLIP-seq
MIRT923793	hsa-miR-3175	CLIP-seq
MIRT923794	hsa-miR-3176	CLIP-seq
MIRT923795	hsa-miR-3177-3p	CLIP-seq
MIRT923796	hsa-miR-3184	CLIP-seq
MIRT923797	hsa-miR-3189-5p	CLIP-seq
MIRT923798	hsa-miR-3200-5p	CLIP-seq
MIRT923799	hsa-miR-320a	CLIP-seq
MIRT923800	hsa-miR-320b	CLIP-seq
MIRT923801	hsa-miR-320c	CLIP-seq
MIRT923802	hsa-miR-320d	CLIP-seq
MIRT923803	hsa-miR-331-3p	CLIP-seq
MIRT923804	hsa-miR-3607-3p	CLIP-seq
MIRT923805	hsa-miR-3609	CLIP-seq
MIRT923806	hsa-miR-3619-3p	CLIP-seq
MIRT923807	hsa-miR-3622a-5p	CLIP-seq
MIRT923808	hsa-miR-3651	CLIP-seq
MIRT923809	hsa-miR-3661	CLIP-seq
MIRT923810	hsa-miR-3663-3p	CLIP-seq
MIRT923811	hsa-miR-3665	CLIP-seq
MIRT923812	hsa-miR-3689a-5p	CLIP-seq
MIRT923813	hsa-miR-3689b	CLIP-seq
MIRT923814	hsa-miR-3689e	CLIP-seq
MIRT923815	hsa-miR-3689f	CLIP-seq
MIRT923816	hsa-miR-3690	CLIP-seq
MIRT923817	hsa-miR-3691-3p	CLIP-seq
MIRT923818	hsa-miR-378	CLIP-seq
MIRT923819	hsa-miR-378b	CLIP-seq
MIRT923820	hsa-miR-378c	CLIP-seq
MIRT923821	hsa-miR-378d	CLIP-seq
MIRT923822	hsa-miR-378e	CLIP-seq
MIRT923823	hsa-miR-378f	CLIP-seq
MIRT923824	hsa-miR-378h	CLIP-seq
MIRT923825	hsa-miR-378i	CLIP-seq
MIRT923826	hsa-miR-3918	CLIP-seq
MIRT923827	hsa-miR-3919	CLIP-seq
MIRT923828	hsa-miR-3922-3p	CLIP-seq
MIRT923829	hsa-miR-3929	CLIP-seq
MIRT923830	hsa-miR-3937	CLIP-seq
MIRT923831	hsa-miR-422a	CLIP-seq
MIRT923832	hsa-miR-423-5p	CLIP-seq
MIRT923833	hsa-miR-4259	CLIP-seq
MIRT923834	hsa-miR-4269	CLIP-seq
MIRT923835	hsa-miR-4270	CLIP-seq
MIRT923836	hsa-miR-4292	CLIP-seq
MIRT923837	hsa-miR-4308	CLIP-seq
MIRT923838	hsa-miR-4311	CLIP-seq
MIRT923839	hsa-miR-4316	CLIP-seq
MIRT923840	hsa-miR-4419b	CLIP-seq
MIRT923841	hsa-miR-4429	CLIP-seq
MIRT923842	hsa-miR-4435	CLIP-seq
MIRT923843	hsa-miR-4441	CLIP-seq
MIRT923844	hsa-miR-4446-5p	CLIP-seq
MIRT923845	hsa-miR-4447	CLIP-seq
MIRT923846	hsa-miR-4472	CLIP-seq
MIRT923847	hsa-miR-4477a	CLIP-seq
MIRT923848	hsa-miR-4478	CLIP-seq
MIRT923849	hsa-miR-4480	CLIP-seq
MIRT923850	hsa-miR-4481	CLIP-seq
MIRT923851	hsa-miR-4496	CLIP-seq
MIRT923852	hsa-miR-450b-5p	CLIP-seq
MIRT923853	hsa-miR-4520a-3p	CLIP-seq
MIRT923854	hsa-miR-4525	CLIP-seq
MIRT923855	hsa-miR-4638-3p	CLIP-seq
MIRT923856	hsa-miR-4640-5p	CLIP-seq
MIRT923857	hsa-miR-4650-5p	CLIP-seq
MIRT923858	hsa-miR-4651	CLIP-seq
MIRT923859	hsa-miR-4665-5p	CLIP-seq
MIRT923860	hsa-miR-4685-5p	CLIP-seq
MIRT923861	hsa-miR-4687-5p	CLIP-seq
MIRT923862	hsa-miR-4706	CLIP-seq
MIRT923863	hsa-miR-4710	CLIP-seq
MIRT923864	hsa-miR-4722-5p	CLIP-seq
MIRT923865	hsa-miR-4723-5p	CLIP-seq
MIRT923866	hsa-miR-4726-3p	CLIP-seq
MIRT923867	hsa-miR-4726-5p	CLIP-seq
MIRT923868	hsa-miR-4728-5p	CLIP-seq
MIRT923869	hsa-miR-4732-3p	CLIP-seq
MIRT923870	hsa-miR-4743	CLIP-seq
MIRT923871	hsa-miR-4745-5p	CLIP-seq
MIRT923872	hsa-miR-4747-5p	CLIP-seq
MIRT923873	hsa-miR-4749-5p	CLIP-seq
MIRT923874	hsa-miR-4755-3p	CLIP-seq
MIRT923875	hsa-miR-4759	CLIP-seq
MIRT923876	hsa-miR-4768-3p	CLIP-seq
MIRT923877	hsa-miR-4776-5p	CLIP-seq
MIRT923878	hsa-miR-4779	CLIP-seq
MIRT923879	hsa-miR-4786-3p	CLIP-seq
MIRT923880	hsa-miR-4803	CLIP-seq
MIRT923881	hsa-miR-483-5p	CLIP-seq
MIRT923882	hsa-miR-485-5p	CLIP-seq
MIRT923883	hsa-miR-494	CLIP-seq
MIRT923884	hsa-miR-517a	CLIP-seq
MIRT923885	hsa-miR-517b	CLIP-seq
MIRT923886	hsa-miR-517c	CLIP-seq
MIRT923887	hsa-miR-520d-5p	CLIP-seq
MIRT923888	hsa-miR-520g	CLIP-seq
MIRT923889	hsa-miR-520h	CLIP-seq
MIRT923890	hsa-miR-524-5p	CLIP-seq
MIRT923891	hsa-miR-541	CLIP-seq
MIRT923892	hsa-miR-548a-3p	CLIP-seq
MIRT923893	hsa-miR-548ah	CLIP-seq
MIRT923894	hsa-miR-548e	CLIP-seq
MIRT923895	hsa-miR-548f	CLIP-seq
MIRT923896	hsa-miR-548n	CLIP-seq
MIRT923897	hsa-miR-548t	CLIP-seq
MIRT923898	hsa-miR-558	CLIP-seq
MIRT923899	hsa-miR-564	CLIP-seq
MIRT923900	hsa-miR-571	CLIP-seq
MIRT923901	hsa-miR-608	CLIP-seq
MIRT923902	hsa-miR-615-5p	CLIP-seq
MIRT923903	hsa-miR-625	CLIP-seq
MIRT923904	hsa-miR-631	CLIP-seq
MIRT923905	hsa-miR-654-5p	CLIP-seq
MIRT923906	hsa-miR-657	CLIP-seq
MIRT923907	hsa-miR-663	CLIP-seq
MIRT923908	hsa-miR-876-5p	CLIP-seq
MIRT923909	hsa-miR-935	CLIP-seq
MIRT923910	hsa-miR-939	CLIP-seq
MIRT923794	hsa-miR-3176	CLIP-seq
MIRT923795	hsa-miR-3177-3p	CLIP-seq
MIRT923807	hsa-miR-3622a-5p	CLIP-seq
MIRT923811	hsa-miR-3665	CLIP-seq
MIRT923828	hsa-miR-3922-3p	CLIP-seq
MIRT923829	hsa-miR-3929	CLIP-seq
MIRT923834	hsa-miR-4269	CLIP-seq
MIRT923840	hsa-miR-4419b	CLIP-seq
MIRT923842	hsa-miR-4435	CLIP-seq
MIRT923848	hsa-miR-4478	CLIP-seq
MIRT923882	hsa-miR-485-5p	CLIP-seq
MIRT923891	hsa-miR-541	CLIP-seq
MIRT923899	hsa-miR-564	CLIP-seq
MIRT923905	hsa-miR-654-5p	CLIP-seq
MIRT923906	hsa-miR-657	CLIP-seq
MIRT923773	hsa-miR-1915	CLIP-seq
MIRT923835	hsa-miR-4270	CLIP-seq
MIRT923843	hsa-miR-4441	CLIP-seq
MIRT923866	hsa-miR-4726-3p	CLIP-seq
MIRT923902	hsa-miR-615-5p	CLIP-seq
MIRT923759	hsa-miR-1203	CLIP-seq
MIRT923767	hsa-miR-1291	CLIP-seq
MIRT923769	hsa-miR-146b-3p	CLIP-seq
MIRT923774	hsa-miR-1972	CLIP-seq
MIRT923779	hsa-miR-2355-5p	CLIP-seq
MIRT923785	hsa-miR-3132	CLIP-seq
MIRT923792	hsa-miR-3173-3p	CLIP-seq
MIRT923794	hsa-miR-3176	CLIP-seq
MIRT923795	hsa-miR-3177-3p	CLIP-seq
MIRT923806	hsa-miR-3619-3p	CLIP-seq
MIRT923807	hsa-miR-3622a-5p	CLIP-seq
MIRT923810	hsa-miR-3663-3p	CLIP-seq
MIRT923811	hsa-miR-3665	CLIP-seq
MIRT923817	hsa-miR-3691-3p	CLIP-seq
MIRT923818	hsa-miR-378	CLIP-seq
MIRT923819	hsa-miR-378b	CLIP-seq
MIRT923820	hsa-miR-378c	CLIP-seq
MIRT923821	hsa-miR-378d	CLIP-seq
MIRT923822	hsa-miR-378e	CLIP-seq
MIRT923823	hsa-miR-378f	CLIP-seq
MIRT923824	hsa-miR-378h	CLIP-seq
MIRT923825	hsa-miR-378i	CLIP-seq
MIRT923826	hsa-miR-3918	CLIP-seq
MIRT923828	hsa-miR-3922-3p	CLIP-seq
MIRT923829	hsa-miR-3929	CLIP-seq
MIRT923830	hsa-miR-3937	CLIP-seq
MIRT923831	hsa-miR-422a	CLIP-seq
MIRT923834	hsa-miR-4269	CLIP-seq
MIRT923835	hsa-miR-4270	CLIP-seq
MIRT923839	hsa-miR-4316	CLIP-seq
MIRT923840	hsa-miR-4419b	CLIP-seq
MIRT923842	hsa-miR-4435	CLIP-seq
MIRT923843	hsa-miR-4441	CLIP-seq
MIRT2209200	hsa-miR-4468	CLIP-seq
MIRT923848	hsa-miR-4478	CLIP-seq
MIRT923849	hsa-miR-4480	CLIP-seq
MIRT923850	hsa-miR-4481	CLIP-seq
MIRT923852	hsa-miR-450b-5p	CLIP-seq
MIRT923855	hsa-miR-4638-3p	CLIP-seq
MIRT923857	hsa-miR-4650-5p	CLIP-seq
MIRT2209201	hsa-miR-4663	CLIP-seq
MIRT923860	hsa-miR-4685-5p	CLIP-seq
MIRT923863	hsa-miR-4710	CLIP-seq
MIRT923868	hsa-miR-4728-5p	CLIP-seq
MIRT923870	hsa-miR-4743	CLIP-seq
MIRT923871	hsa-miR-4745-5p	CLIP-seq
MIRT923872	hsa-miR-4747-5p	CLIP-seq
MIRT923874	hsa-miR-4755-3p	CLIP-seq
MIRT923877	hsa-miR-4776-5p	CLIP-seq
MIRT923878	hsa-miR-4779	CLIP-seq
MIRT923882	hsa-miR-485-5p	CLIP-seq
MIRT923898	hsa-miR-558	CLIP-seq
MIRT923899	hsa-miR-564	CLIP-seq
MIRT923906	hsa-miR-657	CLIP-seq
MIRT2209202	hsa-miR-941	CLIP-seq
MIRT2386733	hsa-miR-1324	CLIP-seq
MIRT923783	hsa-miR-3121-5p	CLIP-seq
MIRT923856	hsa-miR-4640-5p	CLIP-seq
MIRT923867	hsa-miR-4726-5p	CLIP-seq
MIRT923760	hsa-miR-1207-3p	CLIP-seq
MIRT923780	hsa-miR-2861	CLIP-seq
MIRT923781	hsa-miR-296-5p	CLIP-seq
MIRT923796	hsa-miR-3184	CLIP-seq
MIRT923832	hsa-miR-423-5p	CLIP-seq

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001701	Process	In utero embryonic development	IEA
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	NAS	12761245
GO:0003779	Function	Actin binding	TAS	8216329
GO:0005515	Function	Protein binding	IPI	12577067, 20215400, 21044950, 23750010, 23926103, 23940795, 25814554, 25839164, 28966017, 35916866
GO:0005522	Function	Profilin binding	ISS
GO:0005737	Component	Cytoplasm	IDA	8838578, 28966017
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	12009525
GO:0005856	Component	Cytoskeleton	IBA
GO:0005856	Component	Cytoskeleton	IDA	24327345
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005911	Component	Cell-cell junction	IEA
GO:0005921	Component	Gap junction	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0007015	Process	Actin filament organization	IEA
GO:0007015	Process	Actin filament organization	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0010643	Process	Cell communication by chemical coupling	IEA
GO:0010644	Process	Cell communication by electrical coupling	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	ISS
GO:0015629	Component	Actin cytoskeleton	TAS	8216329
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030425	Component	Dendrite	IDA	8838578
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	NAS	12009525
GO:0030426	Component	Growth cone	IEA
GO:0030426	Component	Growth cone	ISS
GO:0030863	Component	Cortical cytoskeleton	TAS	17251419
GO:0031915	Process	Positive regulation of synaptic plasticity	IEA
GO:0031915	Process	Positive regulation of synaptic plasticity	ISS
GO:0032507	Process	Maintenance of protein location in cell	IEA
GO:0042641	Component	Actomyosin	NAS	12761245
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0048168	Process	Regulation of neuronal synaptic plasticity	NAS	12009525
GO:0048699	Process	Generation of neurons	IEA
GO:0050773	Process	Regulation of dendrite development	NAS	12009525
GO:0061003	Process	Positive regulation of dendritic spine morphogenesis	IEA
GO:0061003	Process	Positive regulation of dendritic spine morphogenesis	ISS
GO:0061351	Process	Neural precursor cell proliferation	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0071944	Component	Cell periphery	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099524	Component	Postsynaptic cytosol	IEA
GO:0140311	Function	Protein sequestering activity	IDA	28966017
GO:1902685	Process	Positive regulation of receptor localization to synapse	IEA
GO:1902685	Process	Positive regulation of receptor localization to synapse	ISS

MIM	HGNC	e!Ensembl
126660	2695	ENSG00000113758

Q16643

Protein name

Drebrin (Developmentally-regulated brain protein)

Protein function

Actin cytoskeleton-organizing protein that plays a role in the formation of cell projections (PubMed:20215400). Required for actin polymerization at immunological synapses (IS) and for the recruitment of the chemokine receptor CXCR4 to IS (PubMe

PDB

5Y1Z , 5ZZ9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00241	Cofilin_ADF	13 → 132	Cofilin/tropomyosin-type actin-binding protein	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain, with expression in the molecular layer of the dentate gyrus, stratum pyramidale, and stratum radiatum of the hippocampus (at protein level) (PubMed:8838578). Also expressed in the terminal varicosities distribut

Sequence

MAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFEN
QKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASS
VEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQF
WEQAKKEEELRKEEERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQ
TLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERV
ASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVT
SSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAED
LMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWP
GNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPP
ATFCDPEEVEGESLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQ
SQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEEGFEGGD

Sequence length

649

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (51)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	22310934	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22760556, 22832605, 28966017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	31001081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27013612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27013612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	19945534	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	22760556		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	22760556, 35821008	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25839164, 28865028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16185277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20183806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	16185277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34092977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25839164, 28865028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	18372080, 27802241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28966017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	22310934	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30880752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30880752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28198431, 28865022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Digestive System Disorders	Digestive System Disorders	BEFREE	28966017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	14701734, 20183806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31001081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31001081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23201135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23201135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23201135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	17379343, 18372080, 23804095, 27802241, 28398234, 28865018, 28865024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	14701734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	33453340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26785729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	36690273	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28319065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25839164, 28865028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28319065, 28865033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30880752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33748290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	14701734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21242119, 25839164, 30880752		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	17379343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	12009525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31001081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21242119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28198431, 28865022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	31001081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28319065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28319065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	15140563, 16402129, 23566496		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	16402129		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin neoplasm	Pubtator	16185277	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DBN1 (drebrin 1)