Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1622
Gene name	Diazepam binding inhibitor, acyl-CoA binding protein
Gene symbol	DBI
Synonyms (NCBI Gene)	ACBD1ACBPCCK-RPEP
Chromosome	2
Chromosome location	2q14.2
Summary	This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid rec

137

Show/Hide all (137)

miRTarBase ID	miRNA	Experiments
MIRT923711	hsa-miR-1224-3p	CLIP-seq
MIRT923712	hsa-miR-1260	CLIP-seq
MIRT923713	hsa-miR-1260b	CLIP-seq
MIRT923714	hsa-miR-1280	CLIP-seq
MIRT923715	hsa-miR-188-3p	CLIP-seq
MIRT923716	hsa-miR-299-5p	CLIP-seq
MIRT923717	hsa-miR-3156-3p	CLIP-seq
MIRT923718	hsa-miR-3942-3p	CLIP-seq
MIRT923719	hsa-miR-4446-5p	CLIP-seq
MIRT923720	hsa-miR-4468	CLIP-seq
MIRT923721	hsa-miR-4710	CLIP-seq
MIRT923722	hsa-miR-4792	CLIP-seq
MIRT923723	hsa-miR-495	CLIP-seq
MIRT923724	hsa-miR-548a-5p	CLIP-seq
MIRT923725	hsa-miR-548ab	CLIP-seq
MIRT923726	hsa-miR-548ac	CLIP-seq
MIRT923727	hsa-miR-548ae	CLIP-seq
MIRT923728	hsa-miR-548aj	CLIP-seq
MIRT923729	hsa-miR-548ak	CLIP-seq
MIRT923730	hsa-miR-548am	CLIP-seq
MIRT923731	hsa-miR-548b-5p	CLIP-seq
MIRT923732	hsa-miR-548c-5p	CLIP-seq
MIRT923733	hsa-miR-548d-3p	CLIP-seq
MIRT923734	hsa-miR-548d-5p	CLIP-seq
MIRT923735	hsa-miR-548h	CLIP-seq
MIRT923736	hsa-miR-548i	CLIP-seq
MIRT923737	hsa-miR-548j	CLIP-seq
MIRT923738	hsa-miR-548k	CLIP-seq
MIRT923739	hsa-miR-548l	CLIP-seq
MIRT923740	hsa-miR-548w	CLIP-seq
MIRT923741	hsa-miR-548x	CLIP-seq
MIRT923742	hsa-miR-548y	CLIP-seq
MIRT923743	hsa-miR-548z	CLIP-seq
MIRT923744	hsa-miR-559	CLIP-seq
MIRT923745	hsa-miR-577	CLIP-seq
MIRT923746	hsa-miR-582-3p	CLIP-seq
MIRT923747	hsa-miR-606	CLIP-seq
MIRT923748	hsa-miR-802	CLIP-seq
MIRT923749	hsa-miR-888	CLIP-seq
MIRT923711	hsa-miR-1224-3p	CLIP-seq
MIRT923750	hsa-miR-1256	CLIP-seq
MIRT923712	hsa-miR-1260	CLIP-seq
MIRT923713	hsa-miR-1260b	CLIP-seq
MIRT923714	hsa-miR-1280	CLIP-seq
MIRT923751	hsa-miR-183	CLIP-seq
MIRT923715	hsa-miR-188-3p	CLIP-seq
MIRT923717	hsa-miR-3156-3p	CLIP-seq
MIRT923752	hsa-miR-3910	CLIP-seq
MIRT923718	hsa-miR-3942-3p	CLIP-seq
MIRT923753	hsa-miR-3943	CLIP-seq
MIRT923754	hsa-miR-4323	CLIP-seq
MIRT923719	hsa-miR-4446-5p	CLIP-seq
MIRT923720	hsa-miR-4468	CLIP-seq
MIRT923755	hsa-miR-4643	CLIP-seq
MIRT923721	hsa-miR-4710	CLIP-seq
MIRT923756	hsa-miR-4717-3p	CLIP-seq
MIRT923722	hsa-miR-4792	CLIP-seq
MIRT923723	hsa-miR-495	CLIP-seq
MIRT923724	hsa-miR-548a-5p	CLIP-seq
MIRT923725	hsa-miR-548ab	CLIP-seq
MIRT923726	hsa-miR-548ac	CLIP-seq
MIRT923727	hsa-miR-548ae	CLIP-seq
MIRT923728	hsa-miR-548aj	CLIP-seq
MIRT923729	hsa-miR-548ak	CLIP-seq
MIRT923730	hsa-miR-548am	CLIP-seq
MIRT923731	hsa-miR-548b-5p	CLIP-seq
MIRT923732	hsa-miR-548c-5p	CLIP-seq
MIRT923733	hsa-miR-548d-3p	CLIP-seq
MIRT923734	hsa-miR-548d-5p	CLIP-seq
MIRT923735	hsa-miR-548h	CLIP-seq
MIRT923736	hsa-miR-548i	CLIP-seq
MIRT923737	hsa-miR-548j	CLIP-seq
MIRT923738	hsa-miR-548k	CLIP-seq
MIRT923739	hsa-miR-548l	CLIP-seq
MIRT923740	hsa-miR-548w	CLIP-seq
MIRT923741	hsa-miR-548x	CLIP-seq
MIRT923742	hsa-miR-548y	CLIP-seq
MIRT923743	hsa-miR-548z	CLIP-seq
MIRT923744	hsa-miR-559	CLIP-seq
MIRT923745	hsa-miR-577	CLIP-seq
MIRT923747	hsa-miR-606	CLIP-seq
MIRT923757	hsa-miR-651	CLIP-seq
MIRT923748	hsa-miR-802	CLIP-seq
MIRT923749	hsa-miR-888	CLIP-seq
MIRT923716	hsa-miR-299-5p	CLIP-seq
MIRT923720	hsa-miR-4468	CLIP-seq
MIRT923721	hsa-miR-4710	CLIP-seq
MIRT923722	hsa-miR-4792	CLIP-seq
MIRT923746	hsa-miR-582-3p	CLIP-seq
MIRT923711	hsa-miR-1224-3p	CLIP-seq
MIRT923750	hsa-miR-1256	CLIP-seq
MIRT923712	hsa-miR-1260	CLIP-seq
MIRT923713	hsa-miR-1260b	CLIP-seq
MIRT923714	hsa-miR-1280	CLIP-seq
MIRT923715	hsa-miR-188-3p	CLIP-seq
MIRT923716	hsa-miR-299-5p	CLIP-seq
MIRT923717	hsa-miR-3156-3p	CLIP-seq
MIRT923752	hsa-miR-3910	CLIP-seq
MIRT1973635	hsa-miR-4264	CLIP-seq
MIRT1973636	hsa-miR-4328	CLIP-seq
MIRT923719	hsa-miR-4446-5p	CLIP-seq
MIRT1973637	hsa-miR-4797-3p	CLIP-seq
MIRT923746	hsa-miR-582-3p	CLIP-seq
MIRT923757	hsa-miR-651	CLIP-seq
MIRT923711	hsa-miR-1224-3p	CLIP-seq
MIRT923750	hsa-miR-1256	CLIP-seq
MIRT923712	hsa-miR-1260	CLIP-seq
MIRT923713	hsa-miR-1260b	CLIP-seq
MIRT923714	hsa-miR-1280	CLIP-seq
MIRT923751	hsa-miR-183	CLIP-seq
MIRT923715	hsa-miR-188-3p	CLIP-seq
MIRT923716	hsa-miR-299-5p	CLIP-seq
MIRT923717	hsa-miR-3156-3p	CLIP-seq
MIRT923752	hsa-miR-3910	CLIP-seq
MIRT1973635	hsa-miR-4264	CLIP-seq
MIRT1973636	hsa-miR-4328	CLIP-seq
MIRT923719	hsa-miR-4446-5p	CLIP-seq
MIRT923720	hsa-miR-4468	CLIP-seq
MIRT923755	hsa-miR-4643	CLIP-seq
MIRT923721	hsa-miR-4710	CLIP-seq
MIRT923756	hsa-miR-4717-3p	CLIP-seq
MIRT923722	hsa-miR-4792	CLIP-seq
MIRT1973637	hsa-miR-4797-3p	CLIP-seq
MIRT923746	hsa-miR-582-3p	CLIP-seq
MIRT923757	hsa-miR-651	CLIP-seq
MIRT923716	hsa-miR-299-5p	CLIP-seq
MIRT923753	hsa-miR-3943	CLIP-seq
MIRT923754	hsa-miR-4323	CLIP-seq
MIRT923720	hsa-miR-4468	CLIP-seq
MIRT923721	hsa-miR-4710	CLIP-seq
MIRT923722	hsa-miR-4792	CLIP-seq
MIRT923727	hsa-miR-548ae	CLIP-seq
MIRT923728	hsa-miR-548aj	CLIP-seq
MIRT923730	hsa-miR-548am	CLIP-seq
MIRT923741	hsa-miR-548x	CLIP-seq
MIRT923747	hsa-miR-606	CLIP-seq
MIRT923749	hsa-miR-888	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
PPARG	Unknown	12015306

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000062	Function	Fatty-acyl-CoA binding	IBA
GO:0000062	Function	Fatty-acyl-CoA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005783	Component	Endoplasmic reticulum	IDA	17953517
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IDA	17953517, 21698759
GO:0005794	Component	Golgi apparatus	IEA
GO:0006631	Process	Fatty acid metabolic process	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0030156	Function	Benzodiazepine receptor binding	TAS	3020548
GO:0032994	Component	Protein-lipid complex	IDA	21079819
GO:0036042	Function	Long-chain fatty acyl-CoA binding	IDA	21079819
GO:0036151	Process	Phosphatidylcholine acyl-chain remodeling	IDA	21079819
GO:0042802	Function	Identical protein binding	IPI	21079819
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145
GO:0097038	Component	Perinuclear endoplasmic reticulum	IDA	21698759
GO:1903060	Process	Negative regulation of protein lipidation	IDA	21079819
GO:2001140	Process	Positive regulation of phospholipid transport	IDA	21079819

MIM	HGNC	e!Ensembl
125950	2690	ENSG00000155368

P07108

Protein name

Acyl-CoA-binding protein (ACBP) (Diazepam-binding inhibitor) (DBI) (Endozepine) (EP)

Protein function

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A

PDB

2CB8 , 2FJ9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00887	ACBP	3 → 83	Acyl CoA binding protein	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart. {ECO:0000269|PubMed:16055366, E

Sequence

MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWN
ELKGTSKEDAMKAYINKVEELKKKYGI

Sequence length

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway		Mitochondrial Fatty Acid Beta-Oxidation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (44)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	29385057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	12661934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	31422903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	14755437, 1664069, 25106036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	14755437, 1664069, 16904689, 25106036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	30921354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30921354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	7794798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Budd-Chiari Syndrome	Budd-Chiari syndrome	BEFREE	29297972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34320944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	25106036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17262885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	BEFREE	30145680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Atresia	Esophageal Atresia	BEFREE	30145680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	24054763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	26932421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31056285, 31390546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37120445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31056285, 31390546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	1664069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Vein Thrombosis	Hepatic Vein Thrombosis	BEFREE	29297972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31685051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	BEFREE	30921354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	30921354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoid congenital adrenal hyperplasia	Congenital lipoid adrenal hyperplasia	Pubtator	1661294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24819876	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24054763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25106036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19815704, 27174013, 27452861, 31056285, 7794798, 8390677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31283949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30938715, 31422903		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Attacks	Panic Disorder	BEFREE	16904689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29264673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	30921354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24054763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	14755437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	14755437, 21035473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	1664069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	26932421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Zellweger Syndrome	Zellweger Syndrome	BEFREE	15102341		★★★★★ ★☆☆☆☆ Found in Text Mining only

DBI (diazepam binding inhibitor, acyl-CoA binding protein)