C16orf82 (chromosome 16 open reading frame 82)

Gene

• Entrez ID: 162083
• Gene name: Chromosome 16 open reading frame 82
• Gene symbol: C16orf82
• Synonyms (NCBI Gene): TNT
• Chromosome: 16
• Chromosome location: 16p12.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT835558	hsa-miR-1208	CLIP-seq
MIRT835559	hsa-miR-4722-3p	CLIP-seq
MIRT835560	hsa-miR-4769-3p	CLIP-seq
MIRT1947578	hsa-miR-135a	CLIP-seq
MIRT1947579	hsa-miR-135b	CLIP-seq
MIRT1947580	hsa-miR-3192	CLIP-seq
MIRT1947581	hsa-miR-4314	CLIP-seq
MIRT1947582	hsa-miR-4522	CLIP-seq
MIRT1947583	hsa-miR-4646-5p	CLIP-seq
MIRT1947584	hsa-miR-4670-3p	CLIP-seq
MIRT1947585	hsa-miR-668	CLIP-seq
MIRT2185536	hsa-miR-1285	CLIP-seq
MIRT2185537	hsa-miR-2052	CLIP-seq
MIRT2185538	hsa-miR-3187-5p	CLIP-seq
MIRT1947580	hsa-miR-3192	CLIP-seq
MIRT1947581	hsa-miR-4314	CLIP-seq
MIRT1947582	hsa-miR-4522	CLIP-seq
MIRT1947583	hsa-miR-4646-5p	CLIP-seq
MIRT835560	hsa-miR-4769-3p	CLIP-seq
MIRT2185539	hsa-miR-520a-5p	CLIP-seq
MIRT2185540	hsa-miR-525-5p	CLIP-seq
MIRT2185541	hsa-miR-612	CLIP-seq
MIRT1947580	hsa-miR-3192	CLIP-seq
MIRT1947581	hsa-miR-4314	CLIP-seq
MIRT1947582	hsa-miR-4522	CLIP-seq
MIRT1947583	hsa-miR-4646-5p	CLIP-seq
MIRT2489730	hsa-miR-3121-5p	CLIP-seq
MIRT2489731	hsa-miR-3176	CLIP-seq
MIRT2489732	hsa-miR-326	CLIP-seq
MIRT2489733	hsa-miR-330-5p	CLIP-seq
MIRT2489734	hsa-miR-3922-3p	CLIP-seq
MIRT2489735	hsa-miR-4757-5p	CLIP-seq
MIRT2489736	hsa-miR-593	CLIP-seq
MIRT2489730	hsa-miR-3121-5p	CLIP-seq
MIRT2489731	hsa-miR-3176	CLIP-seq
MIRT2489732	hsa-miR-326	CLIP-seq
MIRT2489733	hsa-miR-330-5p	CLIP-seq
MIRT2489734	hsa-miR-3922-3p	CLIP-seq
MIRT2489735	hsa-miR-4757-5p	CLIP-seq
MIRT2489736	hsa-miR-593	CLIP-seq

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q7Z2V1
• Protein name: Protein TNT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15765	DUF4694	64 → 216	Domain of unknown function (DUF4694)	Family

• Tissue specificity: TISSUE SPECIFICITY: Preferentially expressed in teratocarcinoma rather than in normal testis.
• Sequence:

  MSLVPGQHCSPSHTRLHLTSPITMGTEPATQNTEFSKGSLIYGVTSPQRGHSQHSEASQG
  PLSLDKPLQLPPIFLEGEKGESSVQNEQEGEPSLQSPSLELQSPAWPRHAGVAQEPLKVS
  SSYLSDTQSSESHVSSVQHPRPEEGSHASLSSGYAGDKEGSDISLVGSHRRVRLNRRLNT
  QAASNQTSQLGSIDPPSSLKSRLTGPAHSTKQTGGKE

• Sequence length: 217

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29618599		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29618599		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	34311709	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29618599		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	34200970	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	34200970	Associate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	30233871		★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	30233871		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29210794		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34096155	Associate	★☆☆☆☆ Found in Text Mining only
Myopathies, Nemaline	Myopathy	BEFREE	12732643		★☆☆☆☆ Found in Text Mining only
NEMALINE MYOPATHY 5	Nemaline myopathy	BEFREE	12732643		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12954121, 30819448, 9865731		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34200970	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28573499		★☆☆☆☆ Found in Text Mining only
Senile cardiac amyloidosis	Senile Cardiac Amyloidosis	BEFREE	30233871		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26253814, 29713086		★☆☆☆☆ Found in Text Mining only