FSIP1 (fibrous sheath interacting protein 1)

Gene

• Entrez ID: 161835
• Gene name: Fibrous sheath interacting protein 1
• Gene symbol: FSIP1
• Synonyms (NCBI Gene): HSD10
• Chromosome: 15
• Chromosome location: 15q14

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025058	hsa-miR-181a-5p	Microarray	17612493
MIRT1005494	hsa-miR-1183	CLIP-seq
MIRT1005495	hsa-miR-1184	CLIP-seq
MIRT1005496	hsa-miR-1205	CLIP-seq
MIRT1005497	hsa-miR-148a	CLIP-seq
MIRT1005498	hsa-miR-148b	CLIP-seq
MIRT1005499	hsa-miR-152	CLIP-seq
MIRT1005500	hsa-miR-200b	CLIP-seq
MIRT1005501	hsa-miR-200c	CLIP-seq
MIRT1005502	hsa-miR-3136-3p	CLIP-seq
MIRT1005503	hsa-miR-3158-5p	CLIP-seq
MIRT1005504	hsa-miR-365	CLIP-seq
MIRT1005505	hsa-miR-3908	CLIP-seq
MIRT1005506	hsa-miR-3942-5p	CLIP-seq
MIRT1005507	hsa-miR-429	CLIP-seq
MIRT1005508	hsa-miR-4436a	CLIP-seq
MIRT1005509	hsa-miR-4474-5p	CLIP-seq
MIRT1005510	hsa-miR-4700-3p	CLIP-seq
MIRT1005511	hsa-miR-4703-5p	CLIP-seq
MIRT1005512	hsa-miR-4705	CLIP-seq
MIRT1005513	hsa-miR-4714-5p	CLIP-seq
MIRT1005514	hsa-miR-4766-3p	CLIP-seq
MIRT1005515	hsa-miR-4766-5p	CLIP-seq
MIRT1005516	hsa-miR-576-5p	CLIP-seq
MIRT1005517	hsa-miR-593	CLIP-seq
MIRT1005518	hsa-miR-664	CLIP-seq
MIRT1005512	hsa-miR-4705	CLIP-seq
MIRT1005495	hsa-miR-1184	CLIP-seq
MIRT1005496	hsa-miR-1205	CLIP-seq
MIRT1005497	hsa-miR-148a	CLIP-seq
MIRT1005498	hsa-miR-148b	CLIP-seq
MIRT1005499	hsa-miR-152	CLIP-seq
MIRT2231556	hsa-miR-186	CLIP-seq
MIRT1005503	hsa-miR-3158-5p	CLIP-seq
MIRT1005505	hsa-miR-3908	CLIP-seq
MIRT1005506	hsa-miR-3942-5p	CLIP-seq
MIRT1005509	hsa-miR-4474-5p	CLIP-seq
MIRT1005511	hsa-miR-4703-5p	CLIP-seq
MIRT1005514	hsa-miR-4766-3p	CLIP-seq
MIRT2231557	hsa-miR-513a-3p	CLIP-seq
MIRT1005517	hsa-miR-593	CLIP-seq

Other IDs

• MIM: 615795
• HGNC: 21674
• e!Ensembl: ENSG00000150667

Protein

• UniProt ID: Q8NA03
• Protein name: Fibrous sheath-interacting protein 1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15554	FSIP1	2 → 394	FSIP1 family	Family

• Sequence:

  MDIIKGNLDGISKPASNSRIRPGSRSSNASLEVLSTEPGSFKVDTASNLNSGKEDHSESS
  NTENRRTSNDDKQESCSEKIKLAEEGSDEDLDLVQHQIISECSDEPKLKELDSQLQDAIQ
  KMKKLDKILAKKQRREKEIKKQGLEMRIKLWEEIKSAKYSEAWQSKEEMENTKKFLSLTA
  VSEETVGPSHEEEDTFSSVFHTQIPPEEYEMQMQKLNKDFTCDVERNESLIKSGKKPFSN
  TEKIELRGKHNQDFIKRNIELAKESRNPVVMVDREKKRLVELLKDLDEKDSGLSSSEGDQ
  SGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPTISSFSPRLENRNNQKPDRDGERNM
  EVTPGEKILRNTKEQRDLHNRLREIDEKLKMMKENVLESTSCLSEEQLKCLLDECILKQK
  SIIKLSSERKKEDIEDVTPVFPQLSRSIISKLLNESETKVQKTEVEDADMLESEECEASK
  GYYLTKALTGHNMSEALVTEAENMKCLQFSKDVIISDTKDYFMSKTLGIGRLKRPSFLDD
  PLYGISVSLSSEDQHLKLSSPENTIADEQETKDAAEECKEP

• Sequence length: 581

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	25879199		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32703935	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29480196		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20513247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	20513247	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	20513247		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21947419, 28860802, 29670371		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25826084, 28674022, 30509973, 30814489, 31713931		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25826084	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32703935	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21947419, 28860802, 29670371		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28086239		★☆☆☆☆ Found in Text Mining only
Choreoathetosis	Choreoathetosis	BEFREE	22132097		★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Choreoathetosis	Pubtator	22132097	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26884257		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	21708223		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	BEFREE	22132097		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	22132097	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	20513247	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	25879199		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25826084, 28674022, 30509973, 30814489, 31713931		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28086239		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21947419, 28860802, 29670371		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25879199, 31713931		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	22132097, 28875337		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23905897		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	21708223		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	22132097	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	32703935	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30520659		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25879199, 26884257, 28860802, 29670371, 30814489		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28086239		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	25879199		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	25879199		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	12393239		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35692888	Stimulate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	29670371		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30509973		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21947419	Associate	★☆☆☆☆ Found in Text Mining only