DAPK3 (death associated protein kinase 3)

Gene

• Entrez ID: 1613
• Gene name: Death associated protein kinase 3
• Gene symbol: DAPK3
• Synonyms (NCBI Gene): DLK, ZIP, ZIPK
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: Death-associated protein kinase 3 (DAPK3) induces morphological changes in apoptosis when overexpressed in mammalian cells. These results suggest that DAPK3 may play a role in the induction of apoptosis. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051054	hsa-miR-17-5p	CLASH	23622248
MIRT048888	hsa-miR-93-5p	CLASH	23622248
MIRT051054	hsa-miR-17-5p	GFP reporter assay, qRT-PCR, Western blot	26117336
MIRT1973524	hsa-miR-1224-3p	CLIP-seq
MIRT1973525	hsa-miR-1247	CLIP-seq
MIRT1973526	hsa-miR-1260	CLIP-seq
MIRT1973527	hsa-miR-1260b	CLIP-seq
MIRT1973528	hsa-miR-1280	CLIP-seq
MIRT1973529	hsa-miR-1288	CLIP-seq
MIRT1973530	hsa-miR-1343	CLIP-seq
MIRT1973531	hsa-miR-1909	CLIP-seq
MIRT1973532	hsa-miR-2861	CLIP-seq
MIRT1973533	hsa-miR-3191	CLIP-seq
MIRT1973534	hsa-miR-3197	CLIP-seq
MIRT1973535	hsa-miR-3199	CLIP-seq
MIRT1973536	hsa-miR-3667-5p	CLIP-seq
MIRT1973537	hsa-miR-378g	CLIP-seq
MIRT1973538	hsa-miR-3940-3p	CLIP-seq
MIRT1973539	hsa-miR-4493	CLIP-seq
MIRT1973540	hsa-miR-4652-5p	CLIP-seq
MIRT1973541	hsa-miR-493	CLIP-seq
MIRT1973542	hsa-miR-662	CLIP-seq
MIRT2209110	hsa-miR-128	CLIP-seq
MIRT2209111	hsa-miR-3154	CLIP-seq
MIRT2209112	hsa-miR-3190	CLIP-seq
MIRT1973536	hsa-miR-3667-5p	CLIP-seq
MIRT1973538	hsa-miR-3940-3p	CLIP-seq
MIRT2209113	hsa-miR-7	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000775	Component	Chromosome, centromeric region	IDA	38009294
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0004672	Function	Protein kinase activity	IDA	38009294
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10356987, 18239682
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	16756490
GO:0005515	Function	Protein binding	IPI	15292222, 15910542, 17126281, 21454679, 21988832, 32707033, 33961781, 35271311, 38009294
GO:0005524	Function	ATP binding	IDA	10356987
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	9488481
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IDA	38009294
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS
GO:0006417	Process	Regulation of translation	IEA
GO:0006468	Process	Protein phosphorylation	IDA	10356987
GO:0006915	Process	Apoptotic process	IDA	10580117
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	12917339
GO:0006940	Process	Regulation of smooth muscle contraction	TAS
GO:0007088	Process	Regulation of mitotic nuclear division	TAS
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	21487036
GO:0008140	Function	CAMP response element binding protein binding	TAS	14685163
GO:0008360	Process	Regulation of cell shape	IEA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010506	Process	Regulation of autophagy	TAS	16756490
GO:0016301	Function	Kinase activity	IEA
GO:0016605	Component	PML body	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017148	Process	Negative regulation of translation	IDA	18995835
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030496	Component	Midbody	IDA	38009294
GO:0030496	Component	Midbody	IEA
GO:0031267	Function	Small GTPase binding	IDA	23454120
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	23454120
GO:0032956	Process	Regulation of actin cytoskeleton organization	TAS
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	10356987
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042802	Function	Identical protein binding	IPI	18239682, 21487036
GO:0042803	Function	Protein homodimerization activity	IDA	18239682
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	TAS	16756490
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	21487036
GO:0043519	Process	Regulation of myosin II filament organization	IEA
GO:0043522	Function	Leucine zipper domain binding	IPI	10580117
GO:0046777	Process	Protein autophosphorylation	IDA	18239682
GO:0046777	Process	Protein autophosphorylation	TAS	16756490
GO:0051893	Process	Regulation of focal adhesion assembly	IDA	23454120
GO:0071346	Process	Cellular response to type II interferon	IDA	18995835
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	21454679
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:2000145	Process	Regulation of cell motility	TAS

Other IDs

• MIM: 603289
• HGNC: 2676
• e!Ensembl: ENSG00000167657

Protein

• UniProt ID: O43293
• Protein name: Death-associated protein kinase 3 (DAP kinase 3) (EC 2.7.11.1) (DAP-like kinase) (Dlk) (MYPT1 kinase) (Zipper-interacting protein kinase) (ZIP-kinase)
• Protein function: Serine/threonine kinase which is involved in the regulation of apoptosis, autophagy, transcription, translation and actin cytoskeleton reorganization. Involved in the regulation of smooth muscle contraction. Regulates both type I (caspase-depend
• PDB: 1YRP, 2J90, 3BHY, 3BQR, 5A6N, 5A6O, 5VJA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	13 → 275	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Isoform 1 and isoform 2 are expressed in the bladder smooth muscle. {ECO:0000269|PubMed:15292222, ECO:0000269|PubMed:17126281}.
• Sequence:

  MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
  IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
  KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
  PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
  FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT
  RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY
  EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
  EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR

• Sequence length: 454

Pathways

KEGG:

Autophagy - animal
Pathways in cancer
Bladder cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acrodermatitis enteropathica	Acrodermatitis Enteropathica	BEFREE	12955721		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28439178		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31307340		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22362584, 25304685		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22362584	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31307340		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28588700		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35368029	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24814693, 29926844		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	35604388	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35604388	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26305337	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12086940		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12086940		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28011458, 28893192		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	23024365		★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	15605081		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	20124481	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	19200579		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24814693, 30033129, 30322882, 30851272		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	31229436		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	28224461		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	35368029	Associate	★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	12086940		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	12086940, 12676562		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20233718, 9563853		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21775533	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22362584, 25304685		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28588700		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31636470		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27126362, 28731173, 9376279		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25831050		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31307340		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21487036, 25831050, 25903140, 26748242, 29218234		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	11742505	Associate	★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31266767		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	9480987		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	11742505	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11435312		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	11435312	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15605081, 20124481, 21487036, 25831050, 27126362, 28075459, 30379613, 30548122		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	31820848		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15605081		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15605081	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28075459		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	25304685		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30322882		★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31636470		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15158159		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	31204218		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	31204218		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27126362, 9376279		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	31266767		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23024365		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25831050		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34375503	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27494820, 28396258		★☆☆☆☆ Found in Text Mining only
Waardenburg syndrome type 2	Waardenburg syndrome	Pubtator	8659547	Associate	★☆☆☆☆ Found in Text Mining only
Waardenburg syndrome type 2A	Waardenburg syndrome	Pubtator	8659547	Associate	★☆☆☆☆ Found in Text Mining only