DAPK1 (death associated protein kinase 1)

Gene

• Entrez ID: 1612
• Gene name: Death associated protein kinase 1
• Gene symbol: DAPK1
• Synonyms (NCBI Gene): DAPK, ROCO3
• Chromosome: 9
• Chromosome location: 9q21.33
• Summary: Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consen

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004738	hsa-miR-214-3p	Microarray, qRT-PCR	19435428
MIRT004738	hsa-miR-214-3p	Microarray, qRT-PCR	19435428
MIRT006690	hsa-miR-103a-3p	Luciferase reporter assay, Western blot	22593189
MIRT006690	hsa-miR-103a-3p	Luciferase reporter assay, Western blot	22593189
MIRT006691	hsa-miR-107	Luciferase reporter assay, Western blot	22593189
MIRT006691	hsa-miR-107	Luciferase reporter assay, Western blot	22593189
MIRT022627	hsa-miR-124-3p	Microarray	18668037
MIRT548653	hsa-miR-376c-3p	PAR-CLIP	21572407
MIRT548651	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT548652	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT548650	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT548649	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT548648	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT548647	hsa-miR-3666	PAR-CLIP	21572407
MIRT548646	hsa-miR-4295	PAR-CLIP	21572407
MIRT548645	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT548644	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT548643	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT548642	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT548641	hsa-miR-448	PAR-CLIP	21572407
MIRT548640	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT440849	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440849	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT732795	hsa-miR-26b-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33839982
MIRT548653	hsa-miR-376c-3p	PAR-CLIP	21572407
MIRT548651	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT548652	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT548650	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT548649	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT548648	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT548647	hsa-miR-3666	PAR-CLIP	21572407
MIRT548646	hsa-miR-4295	PAR-CLIP	21572407
MIRT548645	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT548644	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT548643	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT548642	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT548641	hsa-miR-448	PAR-CLIP	21572407
MIRT548640	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT732795	hsa-miR-26b-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33839982
MIRT923157	hsa-miR-320e	CLIP-seq
MIRT923158	hsa-miR-329	CLIP-seq
MIRT923159	hsa-miR-362-3p	CLIP-seq
MIRT923160	hsa-miR-3915	CLIP-seq
MIRT923161	hsa-miR-3928	CLIP-seq
MIRT923162	hsa-miR-522	CLIP-seq
MIRT923163	hsa-miR-607	CLIP-seq
MIRT1547851	hsa-miR-1272	CLIP-seq
MIRT1547852	hsa-miR-1273f	CLIP-seq
MIRT1547853	hsa-miR-143	CLIP-seq
MIRT1547854	hsa-miR-4324	CLIP-seq
MIRT1547855	hsa-miR-4708-5p	CLIP-seq
MIRT1547856	hsa-miR-4712-3p	CLIP-seq
MIRT1547857	hsa-miR-4714-3p	CLIP-seq
MIRT1547858	hsa-miR-4770	CLIP-seq
MIRT1547859	hsa-miR-505	CLIP-seq
MIRT1973515	hsa-miR-361-5p	CLIP-seq
MIRT1973516	hsa-miR-3653	CLIP-seq
MIRT1973517	hsa-miR-3977	CLIP-seq
MIRT1547852	hsa-miR-1273f	CLIP-seq
MIRT1547853	hsa-miR-143	CLIP-seq
MIRT1547854	hsa-miR-4324	CLIP-seq
MIRT2209084	hsa-miR-4534	CLIP-seq
MIRT1547855	hsa-miR-4708-5p	CLIP-seq
MIRT1547856	hsa-miR-4712-3p	CLIP-seq
MIRT1547858	hsa-miR-4770	CLIP-seq
MIRT2386723	hsa-miR-544	CLIP-seq
MIRT2512949	hsa-miR-1321	CLIP-seq
MIRT2512950	hsa-miR-3182	CLIP-seq
MIRT2512951	hsa-miR-3607-3p	CLIP-seq
MIRT2512952	hsa-miR-3686	CLIP-seq
MIRT2512953	hsa-miR-4419a	CLIP-seq
MIRT2512954	hsa-miR-4510	CLIP-seq
MIRT2512955	hsa-miR-4739	CLIP-seq
MIRT2512956	hsa-miR-4756-5p	CLIP-seq
MIRT2512957	hsa-miR-548a-3p	CLIP-seq
MIRT2512958	hsa-miR-548ae	CLIP-seq
MIRT2512959	hsa-miR-548aj	CLIP-seq
MIRT2512960	hsa-miR-548am	CLIP-seq
MIRT2512961	hsa-miR-548e	CLIP-seq
MIRT2512962	hsa-miR-548f	CLIP-seq
MIRT2512963	hsa-miR-548g	CLIP-seq
MIRT2512964	hsa-miR-548x	CLIP-seq
MIRT2512965	hsa-miR-570	CLIP-seq
MIRT2512966	hsa-miR-593	CLIP-seq
MIRT2512957	hsa-miR-548a-3p	CLIP-seq
MIRT2512958	hsa-miR-548ae	CLIP-seq
MIRT2512959	hsa-miR-548aj	CLIP-seq
MIRT2512960	hsa-miR-548am	CLIP-seq
MIRT2512961	hsa-miR-548e	CLIP-seq
MIRT2512962	hsa-miR-548f	CLIP-seq
MIRT2512963	hsa-miR-548g	CLIP-seq
MIRT2512964	hsa-miR-548x	CLIP-seq
MIRT2512965	hsa-miR-570	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPB	Unknown	19521987
HOXB7	Repression	17540169
MBD2	Unknown	21693597

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002357	Process	Defense response to tumor cell	IMP	30429596
GO:0002834	Process	Regulation of response to tumor cell	IDA	11573098
GO:0004672	Function	Protein kinase activity	IDA	7828849, 12730201
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	16756490
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	IDA	10629061
GO:0005515	Function	Protein binding	IPI	15616583, 16132846, 19180116, 19712061, 20220139, 20389280, 21725354, 25241761, 25619834, 25852190, 27068745, 28169274, 29513927, 32707033
GO:0005516	Function	Calmodulin binding	EXP	20103772
GO:0005516	Function	Calmodulin binding	IDA	10629061
GO:0005516	Function	Calmodulin binding	IEA
GO:0005516	Function	Calmodulin binding	IPI	20103772
GO:0005524	Function	ATP binding	IDA	10629061
GO:0005524	Function	ATP binding	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12730201
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	12730201
GO:0006417	Process	Regulation of translation	IEA
GO:0006468	Process	Protein phosphorylation	IDA	10629061
GO:0006468	Process	Protein phosphorylation	TAS	16756490
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IGI	7828849
GO:0006915	Process	Apoptotic process	IMP	10629061
GO:0007165	Process	Signal transduction	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010506	Process	Regulation of autophagy	TAS	16756490
GO:0010508	Process	Positive regulation of autophagy	IMP	22095288
GO:0014069	Component	Postsynaptic density	IEA
GO:0015629	Component	Actin cytoskeleton	IDA	10629061
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017075	Function	Syntaxin-1 binding	IPI	12730201
GO:0017148	Process	Negative regulation of translation	IDA	18995835
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	10629061
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042802	Function	Identical protein binding	IPI	19180116, 19712061, 21738225
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	TAS	16756490
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	16132846
GO:0043065	Process	Positive regulation of apoptotic process	IMP	10629061
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043226	Component	Organelle	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	10629061, 12730201
GO:0046777	Process	Protein autophosphorylation	TAS	16756490
GO:0071346	Process	Cellular response to type II interferon	IDA	18995835
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0071447	Process	Cellular response to hydroperoxide	IMP	22095288
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0097190	Process	Apoptotic signaling pathway	IMP	7828849
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1904094	Process	Positive regulation of autophagic cell death	IMP	11980920
GO:1990722	Component	DAPK1-calmodulin complex	IPI	20103772
GO:2000310	Process	Regulation of NMDA receptor activity	ISS

Other IDs

• MIM: 600831
• HGNC: 2674
• e!Ensembl: ENSG00000196730

Protein

• UniProt ID: P53355
• Protein name: Death-associated protein kinase 1 (DAP kinase 1) (EC 2.7.11.1)
• Protein function: Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell deaths signal, depending on t
• PDB: 1IG1, 1JKK, 1JKL, 1JKS, 1JKT, 1P4F, 1WVW, 1WVX, 1WVY, 1YR5, 2W4J, 2W4K, 2X0G, 2XUU, 2XZS, 2Y0A, 2Y4P, 2Y4V, 2YAK, 3DFC, 3DGK, 3EH9, 3EHA, 3F5G, 3F5U, 3GU4, 3GU5, 3GU6, 3GU7, 3GU8, 3GUB, 3ZXT, 4B4L, 4PF4, 4TL0, 4TXC, 4UV0, 4YO4, 4YPD, 5AUT, 5AUU, 5AUV, 5AUW, 5AUX, 5AUY, 5AUZ, 5AV0, 5AV1, 5AV2, 5AV3, 5AV4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	13 → 275	Protein kinase domain	Domain
  PF00023	Ank	444 → 476	Ankyrin repeat	Repeat
  PF00023	Ank	477 → 509	Ankyrin repeat	Repeat
  PF00023	Ank	510 → 542	Ankyrin repeat	Repeat
  PF00023	Ank	576 → 608	Ankyrin repeat	Repeat
  PF00023	Ank	609 → 641	Ankyrin repeat	Repeat
  PF00531	Death	1310 → 1396	Death domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 2 is expressed in normal intestinal tissue as well as in colorectal carcinomas. {ECO:0000269|PubMed:18422656}.
• Sequence:

  MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
  IEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
  KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
  PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEY
  FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
  ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
  QHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAVYWAA
  RHGHVDTLKFLSENKCPLDVKDKSGEMALHVAARYGHADVAQLLCSFGSNPNIQDKEEET
  PLHCAAWHGYYSVAKALCEAGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAC
  DKDGHIALHLAVRRCQMEVIKTLLSQGCFVDYQDRHGNTPLHVACKDGNMPIVVALCEAN
  CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGASVEALTTDGKTAEDLARSEQHEHVAG
  LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRR
  PRLSSTNSSRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
  THHPHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVVVF
  SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLQVVLVATHADIMNVPRPAGG
  EFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCP
  PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEEDLRRIAQQLHSTGE
  INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVEE
  LLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPF
  PCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRG
  LETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA
  QTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPP
  DPLGKDWCLLAMNLGLPDLVAKYNTSNGAPKDFLPSPLHALLREWTTYPESTVGTLMSKL
  RELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR

• Sequence length: 1430

Pathways

KEGG:

Autophagy - animal
Pathways in cancer
Bladder cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM, ABDOMINAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, TRANSITIONAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONJUNCTIVAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLBLADDER NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROMES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoepithelial tumor	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY TRACT DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SALIVARY GLAND NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	21918973, 24183913		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	19874806		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	19874806		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	24811488		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	15172992		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15578700, 19926549, 21507233, 30588095		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26722491		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	15172992		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	15172992		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	15172992		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	15959912		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	16762588		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	19665921		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	24071855, 25229255, 26498513		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	17206475		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	24877104		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	15959912		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18336955, 18830724, 31279627, 31978714, 35887339	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	18336955		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	16847012, 21167819, 22785394, 22785395		★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	22420243	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	15959912		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31924195	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15367334	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	17401463		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	17401463	Inhibit	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	17189407, 29807777		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of brain, unspecified	Brain Neoplasms	CTD_human_DG	17319784		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	21694441		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	17160380, 27907054, 28388658, 28435431		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	19018866		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	24814955	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	30414085	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	24269611	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	34389795	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	CTD_human_DG	17319784		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Tumor, Primary	Brain Neoplasms	CTD_human_DG	17319784		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20471512, 20490964, 21497122, 22159596, 26075823, 27998789, 28272917, 28316888, 29545903, 29805560, 30572486, 31528229		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12819009, 19094228, 19917631, 20490964, 21837480, 25986046, 27378792, 29480000, 30912402, 32566040	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17401463, 17868341, 20208141, 25826459, 26626260, 31918125, 32449268, 32566040	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19018866, 22136354		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	15959912	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	30912402	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	26191186	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32449268, 35935258	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	30172480		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	17160380, 27907054, 28388658, 28435431		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	16094112		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15814621, 19781081, 21292647, 25069886, 25848215		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27452040	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17133271, 21922274, 26626260, 37737260	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19047905, 19926549, 21507233	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	17133271	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	15172992		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	26191186		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	15172992		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22549158		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27447806, 28456939, 30718039		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18425396, 25268905, 26267895, 30065752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	23494221		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18425396, 25268905, 26267895, 30065752		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	16039715, 21592569		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	17206475		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	24877104		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	15467712, 17690039, 22230750, 30136419		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	15467712, 22230750, 22429346	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	17690039		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	17133271		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17540163, 17540169, 18940472, 19347729, 21918973, 23383130, 24559316, 27590344		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	17540169		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30182733		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29317503		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	17133271		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21036707		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35572821	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16207479, 22990173, 30460377, 31772156		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16369045, 26363785, 26405175, 27540971, 34092617, 34315829, 35321516, 35487942, 36008952, 36104170, 39969348	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	21212658		★☆☆☆☆ Found in Text Mining only
Conjunctival Diseases	Conjunctival Diseases	CTD_human_DG	23872714		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14555992, 16951219, 17133271, 21922274, 26626260, 31294899		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	17133271		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26937622	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28439098, 28614711, 29949198, 30463177		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22420243		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22420243		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22420243	Stimulate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	24071855, 25229255, 26498513, 27610206, 28324774		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	15959912	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	20514412		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29775889		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	26191186		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	26191186	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	16616114, 17206475		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27447806		★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	30414085	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	LHGDN	15048887		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19224282		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19224282		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21150312	Associate	★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	15467712		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	25922306		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	22785394		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	19695681		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	17401463	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17048097, 26582930		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26582930, 39926603	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26582930		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28467792, 39926603	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	17284367		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	25679997	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21454882	Associate	★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	15507671	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	11980920	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30414085	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	21712187	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	15467712		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	21922274	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	40116629	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23804521		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	14504087		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21036707		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	22549447, 24528084	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20671427, 21918973, 22096027, 28391288, 39650664	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12031912		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19546476, 21918973, 22096027, 24183913		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	19874806		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	22293537		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28412611		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28339067		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	19917631	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	15172992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	17209433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	17477876, 22169480		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	17477876, 19781081, 21292647, 22146010, 22169480, 34257703, 37154150	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29578152	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	14617009, 27101868, 34751409	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26498513, 30020823, 30682070		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	15003890, 24814955, 28324774	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	23275143, 24814955, 28324774		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	30020823		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	14617009	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	19874806		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	17284367		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	16893590		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	17319784		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20471512, 20490964, 21497122, 22159596, 26075823, 27998789, 28272917, 28316888, 29545903, 29805560, 30572486, 31528229		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29775889		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19224282		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28934284		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	17133271		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	16094112		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28740751		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	15172992		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15814621, 19781081, 21292647, 22217548, 25069886, 25848215		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28412611		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22549158, 26075823		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25550789		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11839671, 30632669		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	CTD_human_DG	16762588		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17139167, 17943730, 21302620, 21979297, 22285775, 27787359, 28934284		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17160380, 19522860, 27907054, 28388658, 28435431		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11309270, 15026333, 16520653, 17034532, 17319784, 17690039, 17868341, 18940472, 19506903, 20208141, 21129853, 21302620, 22230750, 22465880, 23245584, 23383130, 24305735, 24314662, 24659425, 25848215, 25903140, 26075823, 28255813, 28934284, 29805560, 29807777, 30460377, 30569876, 30576962, 30911150, 31772156		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	30588095		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18425396, 25268905, 26267895, 30065752		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21036707		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17206475		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	15064737	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28439098, 28614711, 29949198, 30463177		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	22146010	Associate	★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	19196380, 21918973		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	22429346	Associate	★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	27622827		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	30172480	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	BEFREE	14693237		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36245370	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	23320886		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15197802, 22267603, 25229255	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	27622827		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19196380, 21212658, 21918973, 24183913, 25679997		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	CTD_human_DG	19874806		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	21918973, 25679997, 26025663	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelofibrosis	Myelofibrosis	BEFREE	15755503		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19018866		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	19018866		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16520653, 21535891, 23790641, 28893862, 30214290		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	21535891	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	28097431	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12154064, 12850376, 15368319, 15467712, 15753461, 15814621, 16043258, 16502411, 16642478, 16858686, 17048097, 17133271, 17160380, 17189407, 17319784, 17401463, 17477876, 17943730, 17945286, 18026971, 19018866, 19064397, 19755648, 19781081, 19926549, 20471512, 20729138, 20860434, 21129853, 21168190, 21212658, 21302620, 21308683, 21497122, 21516484, 21922274, 22096027, 22136354, 22434665, 23275143, 23320886, 23545262, 24071855, 24314662, 24367530, 24559316, 24811488, 24877104, 25268905, 25367268, 25418895, 25496179, 26267895, 26810771, 27590344, 27787359, 27795443, 27907054, 28231808, 28316888, 28339067, 28388658, 28421310, 28740751, 28934284, 29790687, 29805560, 29949198, 30099696, 30664712, 31173249, 31294899		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	CTD_human_DG	17319784		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30718039, 31248062		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	14500366	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17570703		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30718039, 31248062		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	22293537		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	35132780	Associate	★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	21535891		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	11313923		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17477876, 17606310, 19795445, 20704749, 22169480, 24659425, 26406950, 29578152, 30588095		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
oligodendroglioma	Oligodendroglioma	BEFREE	24877104		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	24877104	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	16502411, 24474250, 34335109	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24474250		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	26191186	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22549158		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31336860, 36830707, 38143770	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	GWASCAT_DG	22293537		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	GWASDB_DG	22293537		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25550789		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22078386, 25550789	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	17133271		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24588959		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21749573, 30718039		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	17401463		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	23872714		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	31565884	Associate	★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28543175		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	27101868		★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	17319784		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30632669		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20053773, 33509203, 37282383	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	39969348	Associate	★☆☆☆☆ Found in Text Mining only
Recurrent Brain Neoplasm	Brain Neoplasms	CTD_human_DG	17319784		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	17133271		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14555992, 16951219, 21922274, 26626260		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	16951219		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	17133271		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30911150		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	CTD_human_DG	23872714		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	23733015	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	23733015	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	CTD_human_DG	16762588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	17189407		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	17133271		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16697107		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	20684002		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	23872714		★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	BEFREE	28324774		★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 20 autosomal recessive	Spastic paraplegia	Pubtator	34751409	Associate	★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	20490964		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12082610, 19148529		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16166431, 17034532, 19836067, 20729138, 21147548, 21507233, 21697000, 30576962, 30588095		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27286455		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21628494, 22438973, 24359512, 25065733, 25147921, 26213212, 27027429, 28251343, 29790687, 36245370, 37470582	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	26213212		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	25575897		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21563216, 22228635, 27027429, 28249042, 29790687		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	25496179		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28255813		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	22420243		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17139167, 17943730, 21302620, 21979297, 22285775, 27787359, 28934284		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15809761		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22160140, 23280118, 24509146, 26810771, 34159686, 38438055	Associate	★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	17133271, 17541304, 18192966		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34831219	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	34831219	Inhibit	★☆☆☆☆ Found in Text Mining only
Treatment related secondary malignancy	Treatment Related Secondary Malignancy	CTD_human_DG	19874806		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25684485, 30912402, 37093683	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	20630662		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17160380, 17541304, 21599969	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28388658	Inhibit	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	17953697, 19272801		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	12773202, 24314662, 30172480, 35682732	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	12773202, 16803511, 16928264, 17894941, 17971771, 20208141, 25826459, 26517242, 26823825, 28351298	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	25922306		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	15526363		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	24877104		★☆☆☆☆ Found in Text Mining only