DGKH (diacylglycerol kinase eta)

Gene

• Entrez ID: 160851
• Gene name: Diacylglycerol kinase eta
• Gene symbol: DGKH
• Synonyms (NCBI Gene): DGKeta
• Chromosome: 13
• Chromosome location: 13q14.11
• Summary: This gene encodes a member of the diacylglycerol kinase (DGK) enzyme family. Members of this family are involved in regulating intracellular concentrations of diacylglycerol and phosphatidic acid. Variation in this gene has been associated with bipolar di

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023493	hsa-miR-1-3p	Microarray	18668037
MIRT711623	hsa-miR-6873-5p	HITS-CLIP	19536157
MIRT711622	hsa-miR-3614-3p	HITS-CLIP	19536157
MIRT711620	hsa-miR-4457	HITS-CLIP	19536157
MIRT711621	hsa-miR-125b-2-3p	HITS-CLIP	19536157
MIRT711618	hsa-miR-6804-5p	HITS-CLIP	19536157
MIRT711619	hsa-miR-513b-5p	HITS-CLIP	19536157
MIRT711616	hsa-miR-3161	HITS-CLIP	19536157
MIRT659056	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT659055	hsa-miR-1207-3p	HITS-CLIP	23824327
MIRT659054	hsa-miR-4744	HITS-CLIP	23824327
MIRT659053	hsa-miR-4509	HITS-CLIP	23824327
MIRT659052	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT659051	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT659050	hsa-miR-766-5p	HITS-CLIP	23824327
MIRT659049	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT659048	hsa-miR-1305	HITS-CLIP	23824327
MIRT659047	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT659046	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT659045	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT478151	hsa-miR-4798-3p	PAR-CLIP	20371350
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT478148	hsa-miR-575	PAR-CLIP	20371350
MIRT478151	hsa-miR-4798-3p	PAR-CLIP	20371350
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT478148	hsa-miR-575	PAR-CLIP	20371350
MIRT478151	hsa-miR-4798-3p	PAR-CLIP	20371350
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT478148	hsa-miR-575	PAR-CLIP	20371350
MIRT545500	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT545499	hsa-miR-4643	PAR-CLIP	21572407
MIRT558399	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT558398	hsa-miR-567	PAR-CLIP	21572407
MIRT558397	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT545498	hsa-miR-466	PAR-CLIP	21572407
MIRT545497	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT558396	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT558394	hsa-miR-3924	PAR-CLIP	21572407
MIRT558395	hsa-miR-568	PAR-CLIP	21572407
MIRT558393	hsa-miR-297	PAR-CLIP	21572407
MIRT545500	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT545499	hsa-miR-4643	PAR-CLIP	21572407
MIRT545498	hsa-miR-466	PAR-CLIP	21572407
MIRT545497	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT538088	hsa-miR-4282	PAR-CLIP	22012620
MIRT447732	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT538086	hsa-miR-3163	PAR-CLIP	22012620
MIRT538087	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT538085	hsa-miR-545-5p	PAR-CLIP	22012620
MIRT538084	hsa-miR-19a-3p	PAR-CLIP	22012620
MIRT538083	hsa-miR-19b-3p	PAR-CLIP	22012620
MIRT538082	hsa-miR-889-3p	PAR-CLIP	22012620
MIRT478151	hsa-miR-4798-3p	PAR-CLIP	23446348
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	23446348
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	23446348
MIRT478148	hsa-miR-575	PAR-CLIP	23446348
MIRT478151	hsa-miR-4798-3p	PAR-CLIP	23592263
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	23592263
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT478148	hsa-miR-575	PAR-CLIP	23592263
MIRT447732	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT447731	hsa-miR-577	PAR-CLIP	22100165
MIRT447730	hsa-miR-656-3p	PAR-CLIP	22100165
MIRT447729	hsa-miR-3935	PAR-CLIP	22100165
MIRT447728	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT447727	hsa-miR-4452	PAR-CLIP	22100165
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	26701625
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	26701625
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	26701625
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	26701625
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	26701625
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	26701625
MIRT478148	hsa-miR-575	PAR-CLIP	26701625
MIRT478148	hsa-miR-575	PAR-CLIP	26701625
MIRT478148	hsa-miR-575	PAR-CLIP	26701625
MIRT478148	hsa-miR-575	PAR-CLIP	26701625
MIRT478148	hsa-miR-575	PAR-CLIP	26701625
MIRT478148	hsa-miR-575	PAR-CLIP	26701625
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	26701625
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	26701625
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	26701625
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	26701625
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	26701625
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	26701625
MIRT659048	hsa-miR-1305	PAR-CLIP	27292025
MIRT659048	hsa-miR-1305	PAR-CLIP	27292025
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	27292025
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	27292025
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	27292025
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	27292025
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	27292025
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	27292025
MIRT478151	hsa-miR-4798-3p	PAR-CLIP	27292025
MIRT478151	hsa-miR-4798-3p	PAR-CLIP	27292025
MIRT478151	hsa-miR-4798-3p	PAR-CLIP	27292025
MIRT478148	hsa-miR-575	PAR-CLIP	27292025
MIRT478148	hsa-miR-575	PAR-CLIP	27292025
MIRT478148	hsa-miR-575	PAR-CLIP	27292025
MIRT478148	hsa-miR-575	PAR-CLIP	27292025
MIRT478148	hsa-miR-575	PAR-CLIP	27292025
MIRT478148	hsa-miR-575	PAR-CLIP	27292025
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	27292025
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	27292025
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	27292025
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	27292025
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	27292025
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	27292025
MIRT711623	hsa-miR-6873-5p	HITS-CLIP	19536157
MIRT711622	hsa-miR-3614-3p	HITS-CLIP	19536157
MIRT711620	hsa-miR-4457	HITS-CLIP	19536157
MIRT711621	hsa-miR-125b-2-3p	HITS-CLIP	19536157
MIRT711618	hsa-miR-6804-5p	HITS-CLIP	19536157
MIRT711619	hsa-miR-513b-5p	HITS-CLIP	19536157
MIRT711616	hsa-miR-3161	HITS-CLIP	19536157
MIRT659056	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT659055	hsa-miR-1207-3p	HITS-CLIP	23824327
MIRT659054	hsa-miR-4744	HITS-CLIP	23824327
MIRT659053	hsa-miR-4509	HITS-CLIP	23824327
MIRT659052	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT659051	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT659050	hsa-miR-766-5p	HITS-CLIP	23824327
MIRT659049	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT659048	hsa-miR-1305	HITS-CLIP	23824327
MIRT659047	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT659046	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT659045	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT478151	hsa-miR-4798-3p	PAR-CLIP	20371350
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT478148	hsa-miR-575	PAR-CLIP	20371350
MIRT478151	hsa-miR-4798-3p	PAR-CLIP	20371350
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT478148	hsa-miR-575	PAR-CLIP	20371350
MIRT478151	hsa-miR-4798-3p	PAR-CLIP	20371350
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT478148	hsa-miR-575	PAR-CLIP	20371350
MIRT545500	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT545499	hsa-miR-4643	PAR-CLIP	21572407
MIRT558399	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT558398	hsa-miR-567	PAR-CLIP	21572407
MIRT558397	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT545498	hsa-miR-466	PAR-CLIP	21572407
MIRT545497	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT558396	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT558394	hsa-miR-3924	PAR-CLIP	21572407
MIRT558395	hsa-miR-568	PAR-CLIP	21572407
MIRT558393	hsa-miR-297	PAR-CLIP	21572407
MIRT545500	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT545499	hsa-miR-4643	PAR-CLIP	21572407
MIRT545498	hsa-miR-466	PAR-CLIP	21572407
MIRT545497	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT538088	hsa-miR-4282	PAR-CLIP	22012620
MIRT447732	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT538086	hsa-miR-3163	PAR-CLIP	22012620
MIRT538087	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT538085	hsa-miR-545-5p	PAR-CLIP	22012620
MIRT538084	hsa-miR-19a-3p	PAR-CLIP	22012620
MIRT538083	hsa-miR-19b-3p	PAR-CLIP	22012620
MIRT538082	hsa-miR-889-3p	PAR-CLIP	22012620
MIRT478151	hsa-miR-4798-3p	PAR-CLIP	23446348
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	23446348
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	23446348
MIRT478148	hsa-miR-575	PAR-CLIP	23446348
MIRT478151	hsa-miR-4798-3p	PAR-CLIP	23592263
MIRT478150	hsa-miR-6858-3p	PAR-CLIP	23592263
MIRT478149	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT478148	hsa-miR-575	PAR-CLIP	23592263
MIRT447732	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT447731	hsa-miR-577	PAR-CLIP	22100165
MIRT447730	hsa-miR-656-3p	PAR-CLIP	22100165
MIRT447729	hsa-miR-3935	PAR-CLIP	22100165
MIRT447728	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT447727	hsa-miR-4452	PAR-CLIP	22100165
MIRT934219	hsa-miR-3978	CLIP-seq
MIRT1976562	hsa-miR-2115	CLIP-seq
MIRT1976563	hsa-miR-3149	CLIP-seq
MIRT1976564	hsa-miR-3977	CLIP-seq
MIRT1976565	hsa-miR-4330	CLIP-seq
MIRT1976566	hsa-miR-4691-3p	CLIP-seq
MIRT1976567	hsa-miR-4691-5p	CLIP-seq
MIRT1976568	hsa-miR-507	CLIP-seq
MIRT1976569	hsa-miR-516a-3p	CLIP-seq
MIRT1976570	hsa-miR-557	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	IBA
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	IDA	23949095
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	IEA
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	IMP	12810723
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	ISS
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	TAS
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	12810723
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IDA	12810723
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006654	Process	Phosphatidic acid biosynthetic process	IBA
GO:0006654	Process	Phosphatidic acid biosynthetic process	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0015629	Component	Actin cytoskeleton	ISS
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019900	Function	Kinase binding	IPI	12810723
GO:0030168	Process	Platelet activation	IEA
GO:0030168	Process	Platelet activation	TAS
GO:0032093	Function	SAM domain binding	IDA	12810723
GO:0032991	Component	Protein-containing complex	IDA	12810723
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0042802	Function	Identical protein binding	IPI	12810723
GO:0046339	Process	Diacylglycerol metabolic process	IBA
GO:0046339	Process	Diacylglycerol metabolic process	ISS
GO:0046473	Process	Phosphatidic acid metabolic process	IDA	23949095
GO:0046473	Process	Phosphatidic acid metabolic process	IEA
GO:0046486	Process	Glycerolipid metabolic process	IEA
GO:0046834	Process	Lipid phosphorylation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0141212	Process	Phospholipase C/protein kinase C signal transduction	IMP	12810723

Other IDs

• MIM: 604071
• HGNC: 2854
• e!Ensembl: ENSG00000102780

Protein

• UniProt ID: Q86XP1
• Protein name: Diacylglycerol kinase eta (DAG kinase eta) (EC 2.7.1.107) (Diglyceride kinase eta) (DGK-eta)
• Protein function: Diacylglycerol kinase that converts diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and regulates the respective levels of these two bioactive lipids (PubMed:12810723, PubMed:23949095). Thereby, acts as a central switch between the si
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	66 → 158	PH domain	Domain
  PF00130	C1_1	176 → 228	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
  PF00130	C1_1	248 → 301	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
  PF00781	DAGK_cat	332 → 454	Diacylglycerol kinase catalytic domain	Family
  PF00609	DAGK_acc	770 → 927	Diacylglycerol kinase accessory domain	Family
  PF07647	SAM_2	1148 → 1211	SAM domain (Sterile alpha motif)	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 1]: Expressed only in testis, kidney and colon. {ECO:0000269|PubMed:12810723}.; TISSUE SPECIFICITY: [Isoform 2]: Ubiquitously expressed. {ECO:0000269|PubMed:12810723}.
• Sequence:

  MAGAGGQHHPPGAAGGAAAGAGAAVTSAAASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQ
  IRTKTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEAST
  KNANNSFTIITPFRRLMLCAENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYA
  CSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIED
  EDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYHPICPL
  GQCKVSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPA
  QVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGTG
  NDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPGPPEAS
  EEFYMTIYEDSVATHLTKILNSDEHAVVISSAKTLCETVKDFVAKVEKTYDKTLENAVVA
  DAVASKCSVLNEKLEQLLQALHTDSQAAPVLPGLSPLIVEEDAVESSSEESLGESKEQLG
  DDVTKPSSQKAVKPREIMLRANSLKKAVRQVIEEAGKVMDDPTVHPCEPANQSSDYDSTE
  TDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQTDSVPGPAVAASKENLPVLNTRII
  CPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDLDSVDGYSEKCVMNNYFGIGLD
  AKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLP
  SLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKLQH
  HRIAQCRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWE
  DKQKCDSGKPVLRTHLYIHHAIDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQEL
  AHAVNACSHALNKANPRCPESLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEER
  VSNALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVQK
  QKTSSQPVQKWGTEEVAAWLDLLNLGEYKDIFIRHDIRGAELLHLERRDLKDLGIPKVGH
  VKRILQGIKELGRSTPQSEV

• Sequence length: 1220

Pathways

KEGG:

Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Phospholipase D signaling pathway
Choline metabolism in cancer

Reactome:

Effects of PIP2 hydrolysis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER CALCULUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	GWASCAT_DG	25221879		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	21654738	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	27085324		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	17486107, 19358880, 19478689, 21507135, 21654738, 22048461, 22892719, 24958494, 27016658, 27255576, 29936393, 30266033, 30758784		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	17486107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASDB_DG	17486107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	17486107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	17486107, 21654738, 21771265, 22048461, 22892719, 30266033	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21654738, 21771265, 22048461, 22892719, 24958494		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	21654738, 27085324		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21654738, 27085324		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23572183		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	21654738	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36482994	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	20665664		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	GWASDB_DG	22960999		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	22396660, 23719187		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	24958494, 27016658		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	24958494, 27016658		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	24958494, 27016658		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	24958494, 27016658		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	24958494, 27016658		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	24958494, 27016658		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	24958494, 27016658		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23572183		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27255576		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	21654738, 24944871	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	24944871, 30985063		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	22396660, 23719187		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis	Nephrolithiasis	GWASCAT_DG	22396660		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis	Nephrolithiasis	GWASDB_DG	22396660		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis	Nephrolithiasis	Pubtator	22396660, 28361944	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis Calcium Oxalate	Nephrolithiasis	Pubtator	35741705	Associate	★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	20665664		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	27255576		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	24958494		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	21654738, 27085324		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	21654738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urolithiasis	Urolithiasis	Pubtator	28361944	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urolithiasis	Urolithiasis	GWASCAT_DG	30975718		★★☆☆☆ Found in Text Mining + Unknown/Other Associations