Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1601
Gene name	DAB adaptor protein 2
Gene symbol	DAB2
Synonyms (NCBI Gene)	DOC-2DOC2
Chromosome	5
Chromosome location	5p13.1
Summary	This gene encodes a mitogen-responsive phosphoprotein. It is expressed in normal ovarian epithelial cells, but is down-regulated or absent from ovarian carcinoma cell lines, suggesting its role as a tumor suppressor. This protein binds to the SH3 domains

347

Show/Hide all (347)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018855	hsa-miR-335-5p	Microarray	18185580
MIRT030166	hsa-miR-26b-5p	Microarray	19088304
MIRT053634	hsa-miR-93-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24037530
MIRT053634	hsa-miR-93-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24037530
MIRT053634	hsa-miR-93-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blotcolony formation	24037530
MIRT611056	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615732	hsa-miR-4693-3p	HITS-CLIP	23824327
MIRT611055	hsa-miR-7976	HITS-CLIP	23824327
MIRT611054	hsa-miR-3173-5p	HITS-CLIP	23824327
MIRT611053	hsa-miR-6799-3p	HITS-CLIP	23824327
MIRT611052	hsa-miR-146b-3p	HITS-CLIP	23824327
MIRT611051	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT611050	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT611049	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT611048	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT611047	hsa-miR-8061	HITS-CLIP	23824327
MIRT611046	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611056	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT611055	hsa-miR-7976	HITS-CLIP	23824327
MIRT611054	hsa-miR-3173-5p	HITS-CLIP	23824327
MIRT611053	hsa-miR-6799-3p	HITS-CLIP	23824327
MIRT611052	hsa-miR-146b-3p	HITS-CLIP	23824327
MIRT611051	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT611050	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT611049	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT611048	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT611047	hsa-miR-8061	HITS-CLIP	23824327
MIRT611046	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611056	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615732	hsa-miR-4693-3p	HITS-CLIP	23824327
MIRT611055	hsa-miR-7976	HITS-CLIP	23824327
MIRT611054	hsa-miR-3173-5p	HITS-CLIP	23824327
MIRT611053	hsa-miR-6799-3p	HITS-CLIP	23824327
MIRT611052	hsa-miR-146b-3p	HITS-CLIP	23824327
MIRT611051	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT611050	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT611049	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT611048	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT611047	hsa-miR-8061	HITS-CLIP	23824327
MIRT611046	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611056	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615732	hsa-miR-4693-3p	HITS-CLIP	23824327
MIRT611055	hsa-miR-7976	HITS-CLIP	23824327
MIRT611054	hsa-miR-3173-5p	HITS-CLIP	23824327
MIRT611053	hsa-miR-6799-3p	HITS-CLIP	23824327
MIRT611052	hsa-miR-146b-3p	HITS-CLIP	23824327
MIRT611050	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT611049	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT611046	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611056	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT611055	hsa-miR-7976	HITS-CLIP	23824327
MIRT611054	hsa-miR-3173-5p	HITS-CLIP	23824327
MIRT611053	hsa-miR-6799-3p	HITS-CLIP	23824327
MIRT611052	hsa-miR-146b-3p	HITS-CLIP	23824327
MIRT611051	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT611050	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT611049	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT611048	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT611047	hsa-miR-8061	HITS-CLIP	23824327
MIRT611046	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT478464	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT478463	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT478461	hsa-miR-4272	PAR-CLIP	23592263
MIRT478462	hsa-miR-1323	PAR-CLIP	23592263
MIRT478460	hsa-miR-548o-3p	PAR-CLIP	23592263
MIRT478459	hsa-miR-7515	PAR-CLIP	23592263
MIRT478458	hsa-miR-3179	PAR-CLIP	23592263
MIRT478457	hsa-miR-190a-5p	PAR-CLIP	23592263
MIRT478455	hsa-miR-190b	PAR-CLIP	23592263
MIRT478456	hsa-miR-4764-5p	PAR-CLIP	23592263
MIRT478454	hsa-miR-604	PAR-CLIP	23592263
MIRT478453	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT478452	hsa-miR-647	PAR-CLIP	23592263
MIRT732332	hsa-miR-106b-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26769181
MIRT732332	hsa-miR-106b-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26769181
MIRT053634	hsa-miR-93-5p	Luciferase reporter assayqRT-PCRWestern blot	25892549
MIRT053634	hsa-miR-93-5p	Luciferase reporter assayqRT-PCRWestern blot	25892549
MIRT611056	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615732	hsa-miR-4693-3p	HITS-CLIP	23824327
MIRT611055	hsa-miR-7976	HITS-CLIP	23824327
MIRT611054	hsa-miR-3173-5p	HITS-CLIP	23824327
MIRT611053	hsa-miR-6799-3p	HITS-CLIP	23824327
MIRT611052	hsa-miR-146b-3p	HITS-CLIP	23824327
MIRT611051	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT611050	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT611049	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT611048	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT611047	hsa-miR-8061	HITS-CLIP	23824327
MIRT611046	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611056	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT611055	hsa-miR-7976	HITS-CLIP	23824327
MIRT611054	hsa-miR-3173-5p	HITS-CLIP	23824327
MIRT611053	hsa-miR-6799-3p	HITS-CLIP	23824327
MIRT611052	hsa-miR-146b-3p	HITS-CLIP	23824327
MIRT611051	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT611050	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT611049	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT611048	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT611047	hsa-miR-8061	HITS-CLIP	23824327
MIRT611046	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611056	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615732	hsa-miR-4693-3p	HITS-CLIP	23824327
MIRT611055	hsa-miR-7976	HITS-CLIP	23824327
MIRT611054	hsa-miR-3173-5p	HITS-CLIP	23824327
MIRT611053	hsa-miR-6799-3p	HITS-CLIP	23824327
MIRT611052	hsa-miR-146b-3p	HITS-CLIP	23824327
MIRT611051	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT611050	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT611049	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT611048	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT611047	hsa-miR-8061	HITS-CLIP	23824327
MIRT611046	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611056	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615732	hsa-miR-4693-3p	HITS-CLIP	23824327
MIRT611055	hsa-miR-7976	HITS-CLIP	23824327
MIRT611054	hsa-miR-3173-5p	HITS-CLIP	23824327
MIRT611053	hsa-miR-6799-3p	HITS-CLIP	23824327
MIRT611052	hsa-miR-146b-3p	HITS-CLIP	23824327
MIRT611050	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT611049	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT611046	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611056	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT611055	hsa-miR-7976	HITS-CLIP	23824327
MIRT611054	hsa-miR-3173-5p	HITS-CLIP	23824327
MIRT611053	hsa-miR-6799-3p	HITS-CLIP	23824327
MIRT611052	hsa-miR-146b-3p	HITS-CLIP	23824327
MIRT611051	hsa-miR-376a-5p	HITS-CLIP	23824327
MIRT611050	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT611049	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT611048	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT611047	hsa-miR-8061	HITS-CLIP	23824327
MIRT611046	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT478464	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT478463	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT478461	hsa-miR-4272	PAR-CLIP	23592263
MIRT478462	hsa-miR-1323	PAR-CLIP	23592263
MIRT478460	hsa-miR-548o-3p	PAR-CLIP	23592263
MIRT478459	hsa-miR-7515	PAR-CLIP	23592263
MIRT478458	hsa-miR-3179	PAR-CLIP	23592263
MIRT478457	hsa-miR-190a-5p	PAR-CLIP	23592263
MIRT478455	hsa-miR-190b	PAR-CLIP	23592263
MIRT478456	hsa-miR-4764-5p	PAR-CLIP	23592263
MIRT478454	hsa-miR-604	PAR-CLIP	23592263
MIRT478453	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT478452	hsa-miR-647	PAR-CLIP	23592263
MIRT922544	hsa-miR-1267	CLIP-seq
MIRT922545	hsa-miR-3143	CLIP-seq
MIRT922546	hsa-miR-3920	CLIP-seq
MIRT922547	hsa-miR-4474-3p	CLIP-seq
MIRT922548	hsa-miR-4753-5p	CLIP-seq
MIRT922549	hsa-miR-543	CLIP-seq
MIRT922550	hsa-miR-874	CLIP-seq
MIRT1547844	hsa-miR-153	CLIP-seq
MIRT1547845	hsa-miR-4436b-3p	CLIP-seq
MIRT1547846	hsa-miR-448	CLIP-seq
MIRT1547847	hsa-miR-513a-3p	CLIP-seq
MIRT1547848	hsa-miR-548t	CLIP-seq
MIRT2208902	hsa-miR-4803	CLIP-seq
MIRT2428088	hsa-miR-1183	CLIP-seq
MIRT2428089	hsa-miR-1231	CLIP-seq
MIRT2428090	hsa-miR-1271	CLIP-seq
MIRT2428091	hsa-miR-149	CLIP-seq
MIRT2428092	hsa-miR-182	CLIP-seq
MIRT2428093	hsa-miR-187	CLIP-seq
MIRT2428094	hsa-miR-188-3p	CLIP-seq
MIRT2428095	hsa-miR-199a-3p	CLIP-seq
MIRT2428096	hsa-miR-199b-3p	CLIP-seq
MIRT2428097	hsa-miR-3064-5p	CLIP-seq
MIRT2428098	hsa-miR-3129-5p	CLIP-seq
MIRT2428099	hsa-miR-320a	CLIP-seq
MIRT2428100	hsa-miR-320b	CLIP-seq
MIRT2428101	hsa-miR-320c	CLIP-seq
MIRT2428102	hsa-miR-320d	CLIP-seq
MIRT2428103	hsa-miR-320e	CLIP-seq
MIRT2428104	hsa-miR-330-3p	CLIP-seq
MIRT2428105	hsa-miR-335	CLIP-seq
MIRT2428106	hsa-miR-3647-3p	CLIP-seq
MIRT2428107	hsa-miR-4429	CLIP-seq
MIRT1547845	hsa-miR-4436b-3p	CLIP-seq
MIRT2428108	hsa-miR-4476	CLIP-seq
MIRT2428109	hsa-miR-4633-5p	CLIP-seq
MIRT2428110	hsa-miR-4729	CLIP-seq
MIRT2428111	hsa-miR-4794	CLIP-seq
MIRT2428112	hsa-miR-548b-3p	CLIP-seq
MIRT2428113	hsa-miR-579	CLIP-seq
MIRT2428114	hsa-miR-598	CLIP-seq
MIRT2428115	hsa-miR-606	CLIP-seq
MIRT2428116	hsa-miR-936	CLIP-seq
MIRT2428117	hsa-miR-96	CLIP-seq
MIRT2512692	hsa-miR-1292	CLIP-seq
MIRT2512693	hsa-miR-1294	CLIP-seq
MIRT2512694	hsa-miR-1305	CLIP-seq
MIRT2512695	hsa-miR-139-5p	CLIP-seq
MIRT2512696	hsa-miR-140-3p	CLIP-seq
MIRT2512697	hsa-miR-143	CLIP-seq
MIRT2512698	hsa-miR-144	CLIP-seq
MIRT2512699	hsa-miR-150	CLIP-seq
MIRT2512700	hsa-miR-185	CLIP-seq
MIRT2512701	hsa-miR-186	CLIP-seq
MIRT2512702	hsa-miR-190	CLIP-seq
MIRT2512703	hsa-miR-2116	CLIP-seq
MIRT2512704	hsa-miR-25	CLIP-seq
MIRT2512705	hsa-miR-3132	CLIP-seq
MIRT2512706	hsa-miR-3150b-3p	CLIP-seq
MIRT2512707	hsa-miR-3154	CLIP-seq
MIRT2512708	hsa-miR-3166	CLIP-seq
MIRT2512709	hsa-miR-3189-3p	CLIP-seq
MIRT2512710	hsa-miR-32	CLIP-seq
MIRT2512711	hsa-miR-3545-3p	CLIP-seq
MIRT2512712	hsa-miR-3607-5p	CLIP-seq
MIRT2512713	hsa-miR-363	CLIP-seq
MIRT2512714	hsa-miR-3646	CLIP-seq
MIRT2428106	hsa-miR-3647-3p	CLIP-seq
MIRT2512715	hsa-miR-3662	CLIP-seq
MIRT2512716	hsa-miR-3665	CLIP-seq
MIRT2512717	hsa-miR-367	CLIP-seq
MIRT2512718	hsa-miR-3678-3p	CLIP-seq
MIRT2512719	hsa-miR-3689a-3p	CLIP-seq
MIRT2512720	hsa-miR-3689c	CLIP-seq
MIRT2512721	hsa-miR-3691-3p	CLIP-seq
MIRT2512722	hsa-miR-3714	CLIP-seq
MIRT2512723	hsa-miR-375	CLIP-seq
MIRT2512724	hsa-miR-382	CLIP-seq
MIRT2512725	hsa-miR-3934	CLIP-seq
MIRT2512726	hsa-miR-409-3p	CLIP-seq
MIRT2512727	hsa-miR-4260	CLIP-seq
MIRT2512728	hsa-miR-4273	CLIP-seq
MIRT2512729	hsa-miR-4282	CLIP-seq
MIRT2512730	hsa-miR-4283	CLIP-seq
MIRT2512731	hsa-miR-4306	CLIP-seq
MIRT2512732	hsa-miR-4316	CLIP-seq
MIRT2512733	hsa-miR-4471	CLIP-seq
MIRT2428108	hsa-miR-4476	CLIP-seq
MIRT2512734	hsa-miR-4489	CLIP-seq
MIRT2512735	hsa-miR-450b-5p	CLIP-seq
MIRT2512736	hsa-miR-451b	CLIP-seq
MIRT2512737	hsa-miR-4539	CLIP-seq
MIRT2428109	hsa-miR-4633-5p	CLIP-seq
MIRT2512738	hsa-miR-4644	CLIP-seq
MIRT2512739	hsa-miR-4646-5p	CLIP-seq
MIRT2512740	hsa-miR-4650-3p	CLIP-seq
MIRT2512741	hsa-miR-4677-5p	CLIP-seq
MIRT2512742	hsa-miR-4689	CLIP-seq
MIRT2512743	hsa-miR-4700-3p	CLIP-seq
MIRT2512744	hsa-miR-4713-5p	CLIP-seq
MIRT2512745	hsa-miR-4714-5p	CLIP-seq
MIRT2512746	hsa-miR-4736	CLIP-seq
MIRT2512747	hsa-miR-4770	CLIP-seq
MIRT2512748	hsa-miR-4771	CLIP-seq
MIRT2512749	hsa-miR-4777-5p	CLIP-seq
MIRT2512750	hsa-miR-4784	CLIP-seq
MIRT2208902	hsa-miR-4803	CLIP-seq
MIRT2512751	hsa-miR-494	CLIP-seq
MIRT2512752	hsa-miR-518d-5p	CLIP-seq
MIRT2512753	hsa-miR-519b-5p	CLIP-seq
MIRT2512754	hsa-miR-519c-5p	CLIP-seq
MIRT2512755	hsa-miR-520c-5p	CLIP-seq
MIRT2512756	hsa-miR-526a	CLIP-seq
MIRT2512757	hsa-miR-532-3p	CLIP-seq
MIRT2512758	hsa-miR-539	CLIP-seq
MIRT2512759	hsa-miR-548aa	CLIP-seq
MIRT2512760	hsa-miR-548o	CLIP-seq
MIRT2512761	hsa-miR-556-3p	CLIP-seq
MIRT2428113	hsa-miR-579	CLIP-seq
MIRT2512762	hsa-miR-621	CLIP-seq
MIRT2512763	hsa-miR-642a	CLIP-seq
MIRT2512764	hsa-miR-663b	CLIP-seq
MIRT2512765	hsa-miR-765	CLIP-seq
MIRT2512766	hsa-miR-890	CLIP-seq
MIRT2512767	hsa-miR-92a	CLIP-seq
MIRT2512768	hsa-miR-92b	CLIP-seq
MIRT2512769	hsa-miR-940	CLIP-seq
MIRT2512692	hsa-miR-1292	CLIP-seq
MIRT2512693	hsa-miR-1294	CLIP-seq
MIRT2512694	hsa-miR-1305	CLIP-seq
MIRT2512695	hsa-miR-139-5p	CLIP-seq
MIRT2512696	hsa-miR-140-3p	CLIP-seq
MIRT2512697	hsa-miR-143	CLIP-seq
MIRT2512698	hsa-miR-144	CLIP-seq
MIRT2512699	hsa-miR-150	CLIP-seq
MIRT2512700	hsa-miR-185	CLIP-seq
MIRT2512701	hsa-miR-186	CLIP-seq
MIRT2512702	hsa-miR-190	CLIP-seq
MIRT2512703	hsa-miR-2116	CLIP-seq
MIRT2512704	hsa-miR-25	CLIP-seq
MIRT2512705	hsa-miR-3132	CLIP-seq
MIRT2512706	hsa-miR-3150b-3p	CLIP-seq
MIRT2512707	hsa-miR-3154	CLIP-seq
MIRT2512708	hsa-miR-3166	CLIP-seq
MIRT2512709	hsa-miR-3189-3p	CLIP-seq
MIRT2512710	hsa-miR-32	CLIP-seq
MIRT2512711	hsa-miR-3545-3p	CLIP-seq
MIRT2512713	hsa-miR-363	CLIP-seq
MIRT2512714	hsa-miR-3646	CLIP-seq
MIRT2428106	hsa-miR-3647-3p	CLIP-seq
MIRT2512715	hsa-miR-3662	CLIP-seq
MIRT2512716	hsa-miR-3665	CLIP-seq
MIRT2512717	hsa-miR-367	CLIP-seq
MIRT2512718	hsa-miR-3678-3p	CLIP-seq
MIRT2512719	hsa-miR-3689a-3p	CLIP-seq
MIRT2512720	hsa-miR-3689c	CLIP-seq
MIRT2512721	hsa-miR-3691-3p	CLIP-seq
MIRT2512722	hsa-miR-3714	CLIP-seq
MIRT2512723	hsa-miR-375	CLIP-seq
MIRT2512724	hsa-miR-382	CLIP-seq
MIRT2512725	hsa-miR-3934	CLIP-seq
MIRT2512726	hsa-miR-409-3p	CLIP-seq
MIRT2512727	hsa-miR-4260	CLIP-seq
MIRT2512728	hsa-miR-4273	CLIP-seq
MIRT2512729	hsa-miR-4282	CLIP-seq
MIRT2512730	hsa-miR-4283	CLIP-seq
MIRT2512731	hsa-miR-4306	CLIP-seq
MIRT2512732	hsa-miR-4316	CLIP-seq
MIRT2512733	hsa-miR-4471	CLIP-seq
MIRT2428108	hsa-miR-4476	CLIP-seq
MIRT2512734	hsa-miR-4489	CLIP-seq
MIRT2512735	hsa-miR-450b-5p	CLIP-seq
MIRT2512736	hsa-miR-451b	CLIP-seq
MIRT2512737	hsa-miR-4539	CLIP-seq
MIRT2428109	hsa-miR-4633-5p	CLIP-seq
MIRT2512738	hsa-miR-4644	CLIP-seq
MIRT2512739	hsa-miR-4646-5p	CLIP-seq
MIRT2512740	hsa-miR-4650-3p	CLIP-seq
MIRT2512741	hsa-miR-4677-5p	CLIP-seq
MIRT2512742	hsa-miR-4689	CLIP-seq
MIRT2512743	hsa-miR-4700-3p	CLIP-seq
MIRT2512744	hsa-miR-4713-5p	CLIP-seq
MIRT2512745	hsa-miR-4714-5p	CLIP-seq
MIRT2512746	hsa-miR-4736	CLIP-seq
MIRT2512747	hsa-miR-4770	CLIP-seq
MIRT2512748	hsa-miR-4771	CLIP-seq
MIRT2512750	hsa-miR-4784	CLIP-seq
MIRT2208902	hsa-miR-4803	CLIP-seq
MIRT2512751	hsa-miR-494	CLIP-seq
MIRT2512757	hsa-miR-532-3p	CLIP-seq
MIRT2512758	hsa-miR-539	CLIP-seq
MIRT2512759	hsa-miR-548aa	CLIP-seq
MIRT2512760	hsa-miR-548o	CLIP-seq
MIRT2512761	hsa-miR-556-3p	CLIP-seq
MIRT2428113	hsa-miR-579	CLIP-seq
MIRT2512762	hsa-miR-621	CLIP-seq
MIRT2512763	hsa-miR-642a	CLIP-seq
MIRT2512765	hsa-miR-765	CLIP-seq
MIRT2512766	hsa-miR-890	CLIP-seq
MIRT2512767	hsa-miR-92a	CLIP-seq
MIRT2512768	hsa-miR-92b	CLIP-seq
MIRT2512769	hsa-miR-940	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
GATA6	Activation	16024609
VHL	Activation	15824735

Show/Hide all (65)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	12805222
GO:0001650	Component	Fibrillar center	IDA
GO:0005515	Function	Protein binding	IPI	11387212, 11967127, 12805222, 14596919, 15247260, 15837803, 17474147, 19805065, 20936779, 22491013, 32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005905	Component	Clathrin-coated pit	IBA
GO:0005905	Component	Clathrin-coated pit	IDA	12857860
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006897	Process	Endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	11387212
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	19581412
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IBA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	15734730
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030136	Component	Clathrin-coated vesicle	IDA	19581412
GO:0030154	Process	Cell differentiation	IEA
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	19581412
GO:0030665	Component	Clathrin-coated vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032349	Process	Positive regulation of aldosterone biosynthetic process	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	12805222
GO:0035026	Process	Leading edge cell differentiation	IMP	19581412
GO:0035615	Function	Clathrin adaptor activity	IBA
GO:0035615	Function	Clathrin adaptor activity	IMP	16984970
GO:0038024	Function	Cargo receptor activity	IBA
GO:0038024	Function	Cargo receptor activity	IMP	16984970
GO:0043066	Process	Negative regulation of apoptotic process	IDA	15734730
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0045807	Process	Positive regulation of endocytosis	IBA
GO:0045807	Process	Positive regulation of endocytosis	IEA
GO:0045807	Process	Positive regulation of endocytosis	IMP	19581412, 21995445
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	12805222
GO:0046332	Function	SMAD binding	IDA	11387212
GO:0048268	Process	Clathrin coat assembly	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048545	Process	Response to steroid hormone	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IEA
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IDA	11387212
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IMP	16267015
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	12805222
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	ISS
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IEA
GO:1902074	Process	Response to salt	IEA
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	IMP	19581412
GO:2000096	Process	Positive regulation of Wnt signaling pathway, planar cell polarity pathway	IMP	12805222
GO:2000370	Process	Positive regulation of clathrin-dependent endocytosis	IMP	16984970
GO:2000643	Process	Positive regulation of early endosome to late endosome transport	IMP	21995445
GO:2000860	Process	Positive regulation of aldosterone secretion	IEA

MIM	HGNC	e!Ensembl
601236	2662	ENSG00000153071

P98082

Protein name

Disabled homolog 2 (Adaptor molecule disabled-2) (Differentially expressed in ovarian carcinoma 2) (DOC-2) (Differentially-expressed protein 2)

Protein function

Adapter protein that functions as a clathrin-associated sorting protein (CLASP) required for clathrin-mediated endocytosis of selected cargo proteins. Can bind and assemble clathrin, and binds simultaneously to phosphatidylinositol 4,5-bisphosph

PDB

2LSW , 6O5O , 6OVF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00640	PID	50 → 176	Phosphotyrosine interaction domain (PTB/PID)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in deep invaginations, inclusion cysts and the surface epithelial cells of the ovary. Also expressed in breast epithelial cells, spleen, thymus, prostate, testis, macrophages, fibroblasts, lung epithelial cells, placenta, bra

Sequence

MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDV
PDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNK
ISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKK
KIEEASKAVENGSEALMILDDQTNKLKSGVDQMDLFGDMSTPPDLNSPTESKDILLVDLN
SEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAFSANLNFFPTPNPDPFRDDPF
TQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQISNRTGKQEAQ
AGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSV
QSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQ
PNPLDLFKTSAPAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGF
SQPVIFGTSPAVSGWNQPSPFAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFP
APAVSTQPPSMHSSLLVTPPQPPPRAGPPKDISSDAFTALDPLGDKEIKDVKEMFKDFQL
RQPPAVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPR
QVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA

Sequence length

770

Interactions

View interactions

	KEGG		Reactome
	Endocytosis		Gap junction degradation Formation of annular gap junctions Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Teratocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (107)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	11406647, 28394802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31689617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	11406647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	23129580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29044176		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31101868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28457022, 29599136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28457022, 29599136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30878151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	24571439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	24571439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	24571439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	17671122, 28586028, 30459405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11039902, 17115114, 24638085, 29247596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18567755, 24638085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21063401, 40565366	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29254794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17717605, 31969776, 37324188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	39207954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	17671122, 28586028, 30459405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23030416, 24002585, 24037530, 30547821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	12365030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31101868	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35135489	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11406647, 12365030, 29196616, 8314147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26769181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11406647, 9696034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	GWASDB_DG	20383146, 22479191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30052485, 30275566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30873168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30477644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14612389, 24259968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37510211	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	9696034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	28514805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	32629690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	32629690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27719636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	31451708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	31451708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37361044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	37361044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	21771027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21771027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17009406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17009406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	17009406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	17009406	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17009406	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27036032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	14612389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	9696034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	9696034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	11359772	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	25822971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	LHGDN	16870701		★★★★★ ★☆☆☆☆ Found in Text Mining only
HYPERCHOLESTEROLEMIA, AUTOSOMAL RECESSIVE	Hypercholesterolemia	BEFREE	20088845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29178342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	17009406	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28514805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30052485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	20383146, 31152163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30127897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24037530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	24002585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27036032	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	BEFREE	24608456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17115114, 24638085, 29247596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21771027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17009406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23030416, 24002585, 24037530, 30547821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11406647, 12365030, 29196616, 8314147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11406647, 31101868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	GWASDB_DG	22158540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11812785, 16267015, 24448834, 26143155, 30543885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26774142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17671122, 28586028, 30459405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10340382, 11687976, 12365030, 16267015, 20525238, 21725366, 24608456, 29247596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31474562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17115114, 29247596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17115114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	24608456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	24608456	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23005040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20525238, 25892549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10340382, 11406647, 11687976, 12015763, 12365030, 15754000, 16816378, 17009406, 18593983, 20525238, 20592473, 21725366, 23005040, 24002585, 24037530 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25719979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29247596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29963135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	12365030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	12015763	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	12365030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11406647, 12365030, 29196616, 8314147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12015763, 12365030, 14669280, 15305371, 17009406, 37815603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11406647, 31101868		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	GWASCAT_DG	22158540		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31101868	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11812785, 16267015, 24448834, 26143155, 30543885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11812785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20592473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26774142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32025216	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	16024609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37223105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	17671122, 27003158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16004614, 26769181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	30267088		★★★★★ ★☆☆☆☆ Found in Text Mining only

DAB2 (DAB adaptor protein 2)