Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	159296
Gene name	NK2 homeobox 3
Gene symbol	NKX2-3
Synonyms (NCBI Gene)	CSX3NK2.3NKX2.3NKX2CNKX4-3
Chromosome	10
Chromosome location	10q24.2
Summary	This gene encodes a homeodomain-containing transcription factor. The encoded protein is a member of the NKX family of homeodomain transcription factors. Studies of similar proteins in mouse and rat have indicated a potential role in cellular differentiati

Show/Hide all (68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT637413	hsa-miR-4707-5p	HITS-CLIP	23824327
MIRT637414	hsa-miR-5587-3p	HITS-CLIP	23824327
MIRT637412	hsa-miR-5090	HITS-CLIP	23824327
MIRT637411	hsa-miR-6775-5p	HITS-CLIP	23824327
MIRT637410	hsa-miR-4508	HITS-CLIP	23824327
MIRT667204	hsa-miR-6854-3p	HITS-CLIP	23824327
MIRT637409	hsa-miR-4529-5p	HITS-CLIP	23824327
MIRT637408	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT637407	hsa-miR-6508-3p	HITS-CLIP	23824327
MIRT637406	hsa-miR-6762-5p	HITS-CLIP	23824327
MIRT637405	hsa-miR-6845-5p	HITS-CLIP	23824327
MIRT637404	hsa-miR-6763-3p	HITS-CLIP	23824327
MIRT637403	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT637402	hsa-miR-6727-5p	HITS-CLIP	23824327
MIRT667203	hsa-miR-4727-5p	HITS-CLIP	23824327
MIRT667202	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT667201	hsa-miR-544a	HITS-CLIP	23824327
MIRT667200	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT637413	hsa-miR-4707-5p	HITS-CLIP	23824327
MIRT637414	hsa-miR-5587-3p	HITS-CLIP	23824327
MIRT637412	hsa-miR-5090	HITS-CLIP	23824327
MIRT637411	hsa-miR-6775-5p	HITS-CLIP	23824327
MIRT637410	hsa-miR-4508	HITS-CLIP	23824327
MIRT637409	hsa-miR-4529-5p	HITS-CLIP	23824327
MIRT637408	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT637407	hsa-miR-6508-3p	HITS-CLIP	23824327
MIRT637406	hsa-miR-6762-5p	HITS-CLIP	23824327
MIRT637405	hsa-miR-6845-5p	HITS-CLIP	23824327
MIRT637404	hsa-miR-6763-3p	HITS-CLIP	23824327
MIRT637403	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT637402	hsa-miR-6727-5p	HITS-CLIP	23824327
MIRT637413	hsa-miR-4707-5p	HITS-CLIP	23824327
MIRT637414	hsa-miR-5587-3p	HITS-CLIP	23824327
MIRT637412	hsa-miR-5090	HITS-CLIP	23824327
MIRT637411	hsa-miR-6775-5p	HITS-CLIP	23824327
MIRT637410	hsa-miR-4508	HITS-CLIP	23824327
MIRT667204	hsa-miR-6854-3p	HITS-CLIP	23824327
MIRT637409	hsa-miR-4529-5p	HITS-CLIP	23824327
MIRT637408	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT637407	hsa-miR-6508-3p	HITS-CLIP	23824327
MIRT637406	hsa-miR-6762-5p	HITS-CLIP	23824327
MIRT637405	hsa-miR-6845-5p	HITS-CLIP	23824327
MIRT637404	hsa-miR-6763-3p	HITS-CLIP	23824327
MIRT637403	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT637402	hsa-miR-6727-5p	HITS-CLIP	23824327
MIRT667203	hsa-miR-4727-5p	HITS-CLIP	23824327
MIRT667202	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT667201	hsa-miR-544a	HITS-CLIP	23824327
MIRT667200	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT637413	hsa-miR-4707-5p	HITS-CLIP	23824327
MIRT637414	hsa-miR-5587-3p	HITS-CLIP	23824327
MIRT637412	hsa-miR-5090	HITS-CLIP	23824327
MIRT637411	hsa-miR-6775-5p	HITS-CLIP	23824327
MIRT637410	hsa-miR-4508	HITS-CLIP	23824327
MIRT637409	hsa-miR-4529-5p	HITS-CLIP	23824327
MIRT637408	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT637407	hsa-miR-6508-3p	HITS-CLIP	23824327
MIRT637406	hsa-miR-6762-5p	HITS-CLIP	23824327
MIRT637405	hsa-miR-6845-5p	HITS-CLIP	23824327
MIRT637404	hsa-miR-6763-3p	HITS-CLIP	23824327
MIRT637403	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT637402	hsa-miR-6727-5p	HITS-CLIP	23824327
MIRT1186541	hsa-miR-1254	CLIP-seq
MIRT1186542	hsa-miR-2861	CLIP-seq
MIRT1186543	hsa-miR-3116	CLIP-seq
MIRT1186544	hsa-miR-4512	CLIP-seq
MIRT1186545	hsa-miR-513c	CLIP-seq
MIRT1186546	hsa-miR-514b-5p	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001708	Process	Cell fate specification	IEA
GO:0001776	Process	Leukocyte homeostasis	IEA
GO:0002317	Process	Plasma cell differentiation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006641	Process	Triglyceride metabolic process	IEA
GO:0006955	Process	Immune response	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0010467	Process	Gene expression	IEA
GO:0022612	Process	Gland morphogenesis	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030183	Process	B cell differentiation	IEA
GO:0030225	Process	Macrophage differentiation	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0043367	Process	CD4-positive, alpha-beta T cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046541	Process	Saliva secretion	IEA
GO:0048535	Process	Lymph node development	IEA
GO:0048536	Process	Spleen development	IEA
GO:0048537	Process	Mucosa-associated lymphoid tissue development	IEA
GO:0048541	Process	Peyer's patch development	IEA
GO:0048565	Process	Digestive tract development	IEA
GO:0048621	Process	Post-embryonic digestive tract morphogenesis	IEA
GO:0050678	Process	Regulation of epithelial cell proliferation	IEA
GO:0050900	Process	Leukocyte migration	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
606727	7836	ENSG00000119919

Q8TAU0

Protein name

Homeobox protein Nkx-2.3 (Homeobox protein NK-2 homolog C)

Protein function

Transcription factor.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	149 → 205	Homeodomain	Domain

Sequence

MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGE
EDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQK
SCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREH
LASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKPCVT
PSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAAAAAAAAAAAAAAAYSSSYGCAYPAGGG
GGGGGTSAATTAMQPACSAAGGGPFVNVSNLGGFGSGGSAQPLHQGTAAGAACAQGTLQG
IRAW

Sequence length

364

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	18953328	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	19683022	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20165982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	CTD_human_DG	17554261, 18438405, 18438406	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	LHGDN	18438405	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	18438406, 18500230, 18936107, 19683022, 20165982, 20188614, 21049557, 21514341, 21818367, 21968973, 22377701, 23071489, 23942620, 24473197, 25489960, 31844038 View all (1 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	17554261, 18438405, 18438406	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	17554261, 18438405, 18438406	★★★★★ ★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	17554261, 18438405, 18438406	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	20165982, 20188614, 21049557, 21530736, 21637825, 21803625, 23942620, 24473197, 30891037	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	21049557, 21803625	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27650541	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	27297662	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27297662	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27297662	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	27521992	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28592888	★★★★★ ★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	17554261, 18438405, 18438406	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	18438405, 18500230, 19340882, 21049557, 21514341, 21530736, 21818367, 21968973, 22377701, 23942620, 23974994, 24473197	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	18438405	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	18438405, 18438406, 20228799	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

NKX2-3 (NK2 homeobox 3)