Gene Gene information from NCBI Gene database.
Entrez ID 158866
Gene name ZDHHC palmitoyltransferase 15
Gene symbol ZDHHC15
Synonyms (NCBI Gene)
DHHC15MRX91
Chromosome X
Chromosome location Xq13.3
Summary The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found
miRNA miRNA information provided by mirtarbase database.
300
miRTarBase ID miRNA Experiments Reference
MIRT017787 hsa-miR-335-5p Microarray 18185580
MIRT019337 hsa-miR-148b-3p Microarray 17612493
MIRT645556 hsa-miR-3177-5p HITS-CLIP 23313552
MIRT645555 hsa-miR-6867-5p HITS-CLIP 23313552
MIRT645554 hsa-miR-4666a-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane ISS
GO:0005515 Function Protein binding IPI 32296183
GO:0005783 Component Endoplasmic reticulum IBA
GO:0005794 Component Golgi apparatus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300576 20342 ENSG00000102383
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96MV8
Protein name Palmitoyltransferase ZDHHC15 (EC 2.3.1.225) (Acyltransferase ZDHHC15) (EC 2.3.1.-) (Zinc finger DHHC domain-containing protein 15) (DHHC-15)
Protein function Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates (PubMed:18817523, PubMed:23034182). Has no stringent fatty acid selectivity and in addition to palmitate can also transfer onto target proteins myrista
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01529 DHHC 125 249 DHHC palmitoyltransferase Family
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta, liver, lung, kidney, heart and brain. {ECO:0000269|PubMed:15915161}.
Sequence
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLIL
YHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVY
TRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAY
SVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSR
NKTTLEAFC
TPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSM
NESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET
Sequence length 337
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
10
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Spastic diplegia Likely pathogenic rs1042821596 RCV001281349
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cervical cancer Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DEVELOPMENTAL DISORDER, X-LINKED 91 Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Intellectual disability, X-linked 91 Uncertain significance ClinVar
GWAS catalog
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
LITTLES DISEASE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Amenorrhea Amenorrhea Pubtator 25747126 Associate
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 37161425 Associate
★☆☆☆☆
Found in Text Mining only
Huntington Disease Huntington Disease BEFREE 22155432
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Intellectual developmental disorder Pubtator 23871722 Associate
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Mental retardation BEFREE 26290131, 31189538
★☆☆☆☆
Found in Text Mining only
Mental Retardation, X-Linked Mental retardation BEFREE 15915161
★☆☆☆☆
Found in Text Mining only
MENTAL RETARDATION, X-LINKED 91 (disorder) Mental retardation GENOMICS_ENGLAND_DG 15915161
★☆☆☆☆
Found in Text Mining only
Neuronal Ceroid-Lipofuscinoses Neuronal Ceroid Lipofuscinosis BEFREE 22155432
★☆☆☆☆
Found in Text Mining only
Severe intellectual disability Mental retardation BEFREE 15915161
★☆☆☆☆
Found in Text Mining only