CYP19A1 (cytochrome P450 family 19 subfamily A member 1)

Gene

• Entrez ID: 1588
• Gene name: Cytochrome P450 family 19 subfamily A member 1
• Gene symbol: CYP19A1
• Synonyms (NCBI Gene): ARO, ARO1, CPV1, CYAR, CYP19, CYPXIX, P-450AROM
• Chromosome: 15
• Chromosome location: 15q21.2
• Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006759	hsa-miR-378a-3p	Luciferase reporter assay	21846797
MIRT006759	hsa-miR-378a-3p	Luciferase reporter assay	21846797
MIRT006759	hsa-miR-378a-3p	Luciferase reporter assay	21846797
MIRT006759	hsa-miR-378a-3p	Luciferase reporter assay	21846797
MIRT006759	hsa-miR-378a-3p	Luciferase reporter assay	21846797
MIRT006759	hsa-miR-378a-3p	Luciferase reporter assay	21846797
MIRT006943	hsa-let-7f-5p	Luciferase reporter assay	22407818
MIRT007270	hsa-miR-106a-5p	Luciferase reporter assay	23438603
MIRT007271	hsa-miR-19b-3p	Luciferase reporter assay	23438603
MIRT017035	hsa-miR-335-5p	Microarray	18185580
MIRT052994	hsa-miR-98-5p	Luciferase reporter assay, qRT-PCR, Western blot	22492871
MIRT052994	hsa-miR-98-5p	qRT-PCR, Luciferase reporter assay, Western blot	25496461
MIRT052994	hsa-miR-98-5p	qRT-PCR, Luciferase reporter assay, Western blot	25496461
MIRT735058	hsa-miR-4463	Western blotting, Microarray, qRT-PCR, ELISA	32854459
MIRT920473	hsa-let-7a	CLIP-seq
MIRT920474	hsa-let-7b	CLIP-seq
MIRT920475	hsa-let-7c	CLIP-seq
MIRT920476	hsa-let-7d	CLIP-seq
MIRT920477	hsa-let-7e	CLIP-seq
MIRT920478	hsa-let-7f	CLIP-seq
MIRT920479	hsa-let-7g	CLIP-seq
MIRT920480	hsa-let-7i	CLIP-seq
MIRT920481	hsa-miR-1185	CLIP-seq
MIRT920482	hsa-miR-1208	CLIP-seq
MIRT920483	hsa-miR-1255a	CLIP-seq
MIRT920484	hsa-miR-1255b	CLIP-seq
MIRT920485	hsa-miR-1294	CLIP-seq
MIRT920486	hsa-miR-1304	CLIP-seq
MIRT920487	hsa-miR-1324	CLIP-seq
MIRT920488	hsa-miR-139-5p	CLIP-seq
MIRT920489	hsa-miR-181a	CLIP-seq
MIRT920490	hsa-miR-181b	CLIP-seq
MIRT920491	hsa-miR-181c	CLIP-seq
MIRT920492	hsa-miR-181d	CLIP-seq
MIRT920493	hsa-miR-1911	CLIP-seq
MIRT920494	hsa-miR-202	CLIP-seq
MIRT920495	hsa-miR-25	CLIP-seq
MIRT920496	hsa-miR-3064-3p	CLIP-seq
MIRT920497	hsa-miR-3117-5p	CLIP-seq
MIRT920498	hsa-miR-3120-3p	CLIP-seq
MIRT920499	hsa-miR-3121-3p	CLIP-seq
MIRT920500	hsa-miR-3140-3p	CLIP-seq
MIRT920501	hsa-miR-3159	CLIP-seq
MIRT920502	hsa-miR-3166	CLIP-seq
MIRT920503	hsa-miR-32	CLIP-seq
MIRT920504	hsa-miR-335	CLIP-seq
MIRT920505	hsa-miR-3605-5p	CLIP-seq
MIRT920506	hsa-miR-363	CLIP-seq
MIRT920507	hsa-miR-3659	CLIP-seq
MIRT920508	hsa-miR-367	CLIP-seq
MIRT920509	hsa-miR-3679-5p	CLIP-seq
MIRT920510	hsa-miR-3692	CLIP-seq
MIRT920511	hsa-miR-3918	CLIP-seq
MIRT920512	hsa-miR-3936	CLIP-seq
MIRT920513	hsa-miR-409-3p	CLIP-seq
MIRT920514	hsa-miR-425	CLIP-seq
MIRT920515	hsa-miR-4255	CLIP-seq
MIRT920516	hsa-miR-4262	CLIP-seq
MIRT920517	hsa-miR-4316	CLIP-seq
MIRT920518	hsa-miR-4328	CLIP-seq
MIRT920519	hsa-miR-4420	CLIP-seq
MIRT920520	hsa-miR-4436b-5p	CLIP-seq
MIRT920521	hsa-miR-4458	CLIP-seq
MIRT920522	hsa-miR-4500	CLIP-seq
MIRT920523	hsa-miR-4677-3p	CLIP-seq
MIRT920524	hsa-miR-4712-3p	CLIP-seq
MIRT920525	hsa-miR-4715-3p	CLIP-seq
MIRT920526	hsa-miR-4775	CLIP-seq
MIRT920527	hsa-miR-4776-3p	CLIP-seq
MIRT920528	hsa-miR-513a-3p	CLIP-seq
MIRT920529	hsa-miR-520d-5p	CLIP-seq
MIRT920530	hsa-miR-524-5p	CLIP-seq
MIRT920531	hsa-miR-922	CLIP-seq
MIRT920532	hsa-miR-92a	CLIP-seq
MIRT920533	hsa-miR-92b	CLIP-seq
MIRT920534	hsa-miR-98	CLIP-seq
MIRT920488	hsa-miR-139-5p	CLIP-seq
MIRT920535	hsa-miR-2909	CLIP-seq
MIRT920498	hsa-miR-3120-3p	CLIP-seq
MIRT920500	hsa-miR-3140-3p	CLIP-seq
MIRT920502	hsa-miR-3166	CLIP-seq
MIRT920511	hsa-miR-3918	CLIP-seq
MIRT920536	hsa-miR-4278	CLIP-seq
MIRT920531	hsa-miR-922	CLIP-seq
MIRT1547753	hsa-miR-3170	CLIP-seq
MIRT1547754	hsa-miR-4260	CLIP-seq
MIRT1547755	hsa-miR-4747-5p	CLIP-seq
MIRT1547756	hsa-miR-583	CLIP-seq
MIRT1547757	hsa-miR-615-5p	CLIP-seq
MIRT1972778	hsa-miR-3647-3p	CLIP-seq
MIRT1972779	hsa-miR-4502	CLIP-seq
MIRT920473	hsa-let-7a	CLIP-seq
MIRT920474	hsa-let-7b	CLIP-seq
MIRT920475	hsa-let-7c	CLIP-seq
MIRT920476	hsa-let-7d	CLIP-seq
MIRT920477	hsa-let-7e	CLIP-seq
MIRT920478	hsa-let-7f	CLIP-seq
MIRT920479	hsa-let-7g	CLIP-seq
MIRT920480	hsa-let-7i	CLIP-seq
MIRT920486	hsa-miR-1304	CLIP-seq
MIRT920494	hsa-miR-202	CLIP-seq
MIRT920499	hsa-miR-3121-3p	CLIP-seq
MIRT920501	hsa-miR-3159	CLIP-seq
MIRT2208437	hsa-miR-3675-3p	CLIP-seq
MIRT2208438	hsa-miR-3689a-3p	CLIP-seq
MIRT2208439	hsa-miR-3689c	CLIP-seq
MIRT920513	hsa-miR-409-3p	CLIP-seq
MIRT2208440	hsa-miR-4453	CLIP-seq
MIRT920521	hsa-miR-4458	CLIP-seq
MIRT920522	hsa-miR-4500	CLIP-seq
MIRT2208441	hsa-miR-4538	CLIP-seq
MIRT920528	hsa-miR-513a-3p	CLIP-seq
MIRT2208442	hsa-miR-548u	CLIP-seq
MIRT920534	hsa-miR-98	CLIP-seq
MIRT2512293	hsa-miR-4263	CLIP-seq
MIRT2208442	hsa-miR-548u	CLIP-seq
MIRT2512294	hsa-miR-576-5p	CLIP-seq
MIRT2512293	hsa-miR-4263	CLIP-seq
MIRT2208442	hsa-miR-548u	CLIP-seq
MIRT2512294	hsa-miR-576-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BRCA1	Activation	21087664
BRCA1	Unknown	19445691
CEBPB	Repression	11994385
CEBPB	Unknown	7635140;8603036
CEBPD	Repression	11994385
CREB1	Activation	15955695;16740737
ESR1	Activation	12839940
ESRRA	Activation	15955695;20351196;23340254
ESRRA	Unknown	11973645
FOXL2	Repression	21862621
JUN	Repression	16810058
NFKB1	Repression	15459115
NR0B1	Repression	12213901;22427816
NR2F1	Unknown	11973645
NR2F6	Unknown	11973645
NR3C1	Activation	16740737
NR5A1	Activation	12213901;21087664
NR5A1	Repression	22427816
NR5A2	Unknown	11927588
PGR	Repression	18483177
RARG	Unknown	11973645
RELA	Repression	15459115;18519709
SP1	Unknown	15072557
STAT3	Unknown	15072557
USF1	Repression	12917334
USF2	Repression	12917334
WT1	Repression	12213901

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002677	Process	Negative regulation of chronic inflammatory response	IEA
GO:0004497	Function	Monooxygenase activity	IEA
GO:0005506	Function	Iron ion binding	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006694	Process	Steroid biosynthetic process	IEA
GO:0006694	Process	Steroid biosynthetic process	TAS	2848247
GO:0006703	Process	Estrogen biosynthetic process	TAS
GO:0006710	Process	Androgen catabolic process	IDA	26482249
GO:0006949	Process	Syncytium formation	TAS	27791094
GO:0008209	Process	Androgen metabolic process	IEA
GO:0008209	Process	Androgen metabolic process	IEA
GO:0008395	Function	Steroid hydroxylase activity	TAS
GO:0008585	Process	Female gonad development	IBA
GO:0008585	Process	Female gonad development	IEA
GO:0009055	Function	Electron transfer activity	TAS	2848247
GO:0010760	Process	Negative regulation of macrophage chemotaxis	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	2848247
GO:0016125	Process	Sterol metabolic process	TAS
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	TAS	1371509
GO:0019825	Function	Oxygen binding	TAS	2848247
GO:0020037	Function	Heme binding	IDA	19129847
GO:0020037	Function	Heme binding	IEA
GO:0030540	Process	Female genitalia development	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0032355	Process	Response to estradiol	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0060065	Process	Uterus development	IEA
GO:0060736	Process	Prostate gland growth	IEA
GO:0061370	Process	Testosterone biosynthetic process	IEA
GO:0070330	Function	Aromatase activity	IBA
GO:0070330	Function	Aromatase activity	IDA	19129847, 26482249
GO:0070330	Function	Aromatase activity	IEA
GO:0101021	Function	Estrogen 2-hydroxylase activity	IEA
GO:2000866	Process	Positive regulation of estradiol secretion	IDA	26482249

Other IDs

• MIM: 107910
• HGNC: 2594
• e!Ensembl: ENSG00000137869

Protein

• UniProt ID: P11511
• Protein name: Aromatase (EC 1.14.14.14) (CYPXIX) (Cytochrome P-450AROM) (Cytochrome P450 19A1) (Estrogen synthase)
• Protein function: A cytochrome P450 monooxygenase that catalyzes the conversion of C19 androgens, androst-4-ene-3,17-dione (androstenedione) and testosterone to the C18 estrogens, estrone and estradiol, respectively (PubMed:27702664, PubMed:2848247). Catalyzes th
• PDB: 3EQM, 3S79, 3S7S, 4GL5, 4GL7, 4KQ8, 5JKV, 5JKW, 5JL6, 5JL7, 5JL9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	46 → 488	Cytochrome P450	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed, including in adult and fetal brain, placenta, skin fibroblasts, adipose tissue and gonads. {ECO:0000269|PubMed:2040633, ECO:0000269|PubMed:3018730, ECO:0000269|PubMed:7690033, ECO:0000269|PubMed:8117272}.
• Sequence:

  MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
  SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
  GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
  ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
  YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
  LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
  YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
  NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
  PDETKNMLEMIFTPRNSDRCLEH

• Sequence length: 503

Pathways

KEGG:

Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis

Reactome:

Estrogen biosynthesis
Endogenous sterols
Defective CYP19A1 causes Aromatase excess syndrome (AEXS)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Aromatase deficiency	Pathogenic; Likely pathogenic	rs2141079375, rs2542466633, rs375990501, rs2542394532, rs121434534, rs78310315, rs786205107, rs121434536, rs786205108, rs786205109, rs80051519, rs2542423740, rs786205110, rs121434538, rs769461019, rs768157788, rs2031075939	RCV001832802 RCV005626696 RCV003230825 RCV005013047 RCV000019393 RCV000019394 RCV000019395 RCV000019396 RCV000019397 RCV000019398 RCV000019399 RCV000019400 RCV000019401 RCV000019404 RCV001830765 RCV001827423 RCV001196822	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Aromatase excess syndrome	Likely pathogenic; Pathogenic	rs2542466633, rs375990501, rs2542394532, rs2031075939, rs121434538, rs769461019, rs768157788	RCV005626696 RCV005012822 RCV005013047 RCV003989852 RCV005003394 RCV005012346 RCV002489695	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ADRENAL HYPERPLASIA, CONGENITAL, DUE TO 21-HYDROXYLASE DEFICIENCY	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMENORRHEA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER NECK OBSTRUCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE RESORPTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ADRENAL HYPERPLASIA DUE TO 21 HYDROXYLASE DEFICIENCY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRITICAL ILLNESS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYP19A1-related disorder	Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES, GESTATIONAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADISM	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOPITUITARISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, FEMALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Letrozole response	drug response; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN FAILURE, PREMATURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature ovarian failure	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary disease, chronic obstructive, susceptibility to	association	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYMPTOMS OF DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETHRAL OBSTRUCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
46, XX Disorders of Sex Development	46, XX Disorders of Sex Development	BEFREE	26279340		★☆☆☆☆ Found in Text Mining only
Acanthosis Nigricans	Acanthosis Nigricans	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	29285776		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	29285776		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11753649, 18491956, 20467160, 24242679		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	21472143		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	10704911		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	20710045, 24242679, 24803578		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	30195637		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	26578364, 8686761		★☆☆☆☆ Found in Text Mining only
Adrenal Cancer	Adrenal Cancer	BEFREE	20467160		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	11158024, 12656667, 18508999, 19026713		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	11158024, 14709151, 20467160		★☆☆☆☆ Found in Text Mining only
Adrenal Hyperplasia Congenital	Congenital adrenal hyperplasia	Pubtator	30074481	Associate	★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	10746939, 11228047, 14709151, 16394175, 18157729, 18508999, 18639541, 19026713, 20467160, 21641976, 26464060, 31676319		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	LHGDN	18157729		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	19026713, 20467160, 26464060	Associate	★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	18508999, 30053001		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	19438456, 26228318, 29185104, 29641806		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	16882736, 20932310, 22057025, 23635391, 23736221, 27583919, 31175839	Associate	★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	BEFREE	27256151, 29324451		★☆☆☆☆ Found in Text Mining only
Ambiguous genitalia, female	Ambiguous Genitalia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Amenorrhea	Amenorrhea	Pubtator	8265607	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28583855		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	16533790, 16627980, 17695547, 25955685, 9177396		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	17852420, 8908530, 8980896	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	30519756		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	21119710	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	21119710, 24582702		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	25625755, 26108486, 26969395, 27029552, 27320036, 27801670, 28283903, 29249058, 29666928, 30374289, 31289138, 31434793, 31451366		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	18508999, 30053001		★☆☆☆☆ Found in Text Mining only
Aromatase deficiency	Aromatase Deficiency	CTD_human_DG	10566648, 8265607, 9177373		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Aromatase deficiency	Aromatase Deficiency	BEFREE	14715828, 17547681, 21521281, 24705274, 25301327, 25415177, 26279340, 29324451, 30550360, 30920624, 8200927, 8265607		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Aromatase deficiency	Aromatase Deficiency	ORPHANET_DG	21521281		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Aromatase deficiency	Aromatase Deficiency	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Aromatase deficiency	Aromatase Deficiency	UNIPROT_DG	24705274, 8265607, 8530621, 9211678		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Aromatase deficiency	Aromatase Deficiency	GENOMICS_ENGLAND_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Aromatase deficiency	Aromatase Deficiency	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
AROMATASE EXCESS SYNDROME	Aromatase Excess Syndrome	BEFREE	15811932, 16109840, 16394175, 18083712, 21470988, 23625277, 24064691, 24716396, 28112739, 30530883, 9543166		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
AROMATASE EXCESS SYNDROME	Aromatase Excess Syndrome	ORPHANET_DG	21470988, 22319526, 24064691		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Aromatase excess syndrome	Aromatase Excess Syndrome	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
AROMATASE EXCESS SYNDROME	Aromatase Excess Syndrome	GENOMICS_ENGLAND_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Arteriosclerosis	Arteriosclerosis	BEFREE	11850209, 11904449		★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	21251330, 27747906	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10446859	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	33836687	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11850209, 11904449		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	11904449		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34128950, 35197230	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy of testis	Testicular atrophy	BEFREE	29874772		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	22336992	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	28337664		★☆☆☆☆ Found in Text Mining only
Auditory Perceptual Disorders	Auditory perceptual disorder	Pubtator	28337664	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30442903		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	21359227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	21359227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	21359227	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15314222		★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	24762434		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29394243		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	11158024, 16024248		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	12370109, 16651392, 17911400, 17979523, 18492814, 19921206, 22731640, 26214411, 27277477, 30798199, 31238046, 8844286, 9140125		★☆☆☆☆ Found in Text Mining only
bilateral breast cancer	Breast Cancer	BEFREE	12204674		★☆☆☆☆ Found in Text Mining only
Bilateral Cryptorchidism	Cryptorchidism	BEFREE	24705274		★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	21356374		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27324053, 29303414		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	23643682, 26049585	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	11092403, 26536870	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	23540392	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	28964927		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28178667		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	20043267		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	16835078		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10027313, 10465664, 10470147, 10545204, 10598045, 10657957, 10713305, 10713674, 10730684, 10731103, 10731105, 10861475, 10954253, 10956405, 10996432, 11181459, 11245431, 11280806, 11694352, 11739882, 11850205, 11850224, 11897504, 11916235, 11916629, 11935306, 11955795, 12020974, 12095949, 12114443, 12160997, 12204674, 12351690, 12459711, 12514567, 12569569, 12589939, 12605564, 12618873, 12734209, 12839940, 12888106, 12944421, 14566818, 14580261, 14602139, 14623514, 14623547, 14633737, 14637391, 14654987, 14979917, 14981949, 15072827, 15126575, 15177662, 15298966, 15328175, 15593089, 15642171, 15683469, 15687328, 15695411, 15784178, 15831674, 15955695, 15964185, 16023338, 16024245, 16109840, 16113100, 16170371, 16232327, 16287071, 16303757, 16406421, 16413774, 16480277, 16498361, 16541304, 16556483, 16611627, 16712450, 16740737, 16741831, 16753008, 16755105, 16850246, 16940443, 16954432, 17004113, 17020418, 17047076, 17119036, 17129632, 17215075, 17254854, 17315855, 17325027, 17440110, 17555561, 17562079, 17590327, 17616393, 17624762, 17657731, 17678531, 17761019, 17875734, 17885619, 17934808, 17975727, 18030614, 18045633, 18049890, 18072234, 18079323, 18199708, 18245543, 18248980, 18271519, 18398027, 18445827, 18480557, 18483177, 18519709, 18592373, 18614276, 18614591, 18629629, 18637488, 18637494, 19013891, 19064562, 19065667, 19082882, 19250194, 19250198, 19250199, 19278756, 19366906, 19439415, 19469636, 19487288, 19509226, 19528477, 19589174, 19638208, 19639193, 19645634, 19755984, 19768880, 19773750, 19883757, 19906814, 19931613, 19943105, 20048079, 20052540, 20054641, 20054642, 20101208, 20133979, 20144226, 20151319, 20205115, 20353934, 20374034, 20386540, 20428938, 20432167, 20497094, 20534486, 20644568, 20730598, 20809360, 20817789, 20876420, 20923259, 20960227, 21054398, 21112394, 21185724, 21187493, 21187922, 21251330, 21325863, 21332390, 21362200, 21377485, 21392518, 21393445, 21420422, 21431343, 21477609, 21494765, 21622727, 21658239, 21741436, 21875255, 21939764, 21977969, 22102688, 22128327, 22237979, 22292588, 22300440, 22301800, 22342815, 22350385, 22405131, 22407818, 22508516, 22550166, 22576212, 22722193, 22723326, 22799738, 22855103, 22906881, 22929011, 22939887, 22992372, 23041473, 23090135, 23129173, 23151593, 23160924, 23178495, 23340254, 23342035, 23344024, 23411384, 23493347, 23518928, 23546553, 23566437, 23625277, 23650283, 23652009, 23704778, 23744433, 23780684, 23842740, 23846226, 23869785, 23894347, 23935996, 23958744, 23988612, 24074788, 24163427, 24176089, 24223121, 24242068, 24324964, 24402127, 24413080, 24430361, 24472707, 24529907, 24590773, 24629213, 24634384, 24836190, 24927687, 24928526, 24929094, 25023195, 25088806, 25159103, 25178514, 25178713, 25182769, 25193464, 25284587, 25421376, 25421723, 25476497, 25500870, 25502281, 25543211, 25554091, 25588716, 25625755, 25633049, 25634217, 25683269, 25793413, 25837259, 25888249, 25935582, 25962693, 25976679, 25991817, 26026468, 26033800, 26033813, 26049585, 26059638, 26067721, 26108486, 26113604, 26162914, 26165839, 26191232, 26209254, 26252353, 26255816, 26277097, 26345775, 26346768, 26383165, 26463708, 26464060, 26658964, 26706698, 26798969, 26969395, 27018307, 27029552, 27102200, 27113745, 27137076, 27165202, 27177930, 27186656, 27323034, 27333128, 27343990, 27343991, 27365044, 27423512, 27491861, 27532743, 27561703, 27570979, 27575547, 27616271, 27627986, 27635473, 27659519, 27702664, 27711920, 27747906, 27758888, 27785653, 27793424, 27809310, 27810693, 27825388, 27832985, 27864342, 27900579, 27917746, 27983533, 27998966, 28026901, 28028198, 28045625, 28060751, 28068170, 28083668, 28107349, 28109841, 28112739, 28122888, 28140519, 28144163, 28148596, 28157646, 28167101, 28204994, 28229275, 28251384, 28259297, 28267392, 28270386, 28274582, 28319725, 28323914, 28332172, 28337254, 28337664, 28341383, 28346074, 28356008, 28369967, 28384564, 28389808, 28396197, 28403774, 28404691, 28411130, 28412323, 28413771, 28423398, 28429243, 28443693, 28459598, 28467729, 28469437, 28489882, 28512028, 28526959, 28534527, 28535537, 28571770, 28592202, 28611039, 28615284, 28632237, 28635978, 28639029, 28644496, 28651157, 28655486, 28663087, 28673637, 28690107, 28691132, 28698390, 28742191, 28766132, 28770449, 28776988, 28785180, 28792531, 28801846, 28821472, 28838227, 28838807, 28877935, 28881223, 28919302, 28922781, 28922787, 28947566, 28969348, 28992264, 29031778, 29045530, 29085591, 29090666, 29101597, 29104286, 29116414, 29117210, 29131020, 29131988, 29141657, 29157627, 29168353, 29168427, 29168668, 29202405, 29212847, 29233615, 29243101, 29249058, 29274928, 29293897, 29328860, 29329697, 29336269, 29338443, 29343958, 29344249, 29350307, 29363090, 29380528, 29396856, 29401621, 29455298, 29464186, 29470723, 29482983, 29492753, 29501739, 29520506, 29525337, 29527850, 29530940, 29546343, 29572126, 29581979, 29584567, 29620427, 29644889, 29681616, 29701941, 29702199, 29719441, 29726787, 29739819, 29747931, 29755596, 29765553, 29769099, 29790386, 29794673, 29794680, 29800559, 29845476, 29863451, 29870471, 29890985, 29898754, 29909120, 29912452, 29921733, 29952241, 29963114, 29986672, 29987984, 30012349, 30014974, 30022834, 30036740, 30038708, 30067113, 30077574, 30086432, 30094551, 30150428, 30155484, 30159789, 30190660, 30297439, 30299291, 30303924, 30306326, 30316543, 30328006, 30333087, 30379695, 30386297, 30388923, 30410061, 30415752, 30443921, 30474104, 30479694, 30509771, 30523459, 30546457, 30561133, 30568462, 30583560, 30616553, 30630678, 30658629, 30679317, 30698686, 30709804, 30712236, 30720225, 30742607, 30795951, 30817981, 30822713, 30840336, 30843932, 30868270, 30896247, 30904591, 30920624, 30944027, 30967597, 31011525, 31051411, 31069862, 31079282, 31126332, 31127591, 31129450, 31152327, 31190621, 31201904, 31211741, 31212043, 31235695, 31257015, 31273878, 31292269, 31318068, 31321612, 31327728, 31329454, 31342358, 31352137, 31388303, 31393399, 31425735, 31434793, 31440781, 31477036, 31479143, 31479144, 31500470, 31509915, 31511352, 31518632, 31522348, 31522958, 31527321, 31533365, 31546395, 31548345, 31557516, 31568000, 31584741, 31596961, 31598815, 31606823, 31609762, 31610224, 31610271, 31629071, 31630379, 31641936, 31665091, 31678641, 31694630, 31741759, 31757843, 31816749, 31839166, 31839281, 31847542, 7581491, 7628871, 7949202, 8043495, 8286214, 8476772, 8662988, 8664162, 8923826, 8943788, 8964875, 8989259, 9010331, 9334290, 9365188, 9365201, 9511180, 9696881, 9797013, 9883986		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	11850205, 19639193, 23342035, 28112739, 29701941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Diseases	Breast disease	Pubtator	20682005	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10027313, 10574257, 10731105, 11935306, 12153753, 12618873, 14580261, 15237001, 15642164, 15642171, 15831674, 16303757, 16760268, 16940470, 17004113, 17047076, 17219197, 1739127, 17562079, 17616393, 17661084, 18045633, 18072234, 18079323, 18087590, 18199708, 18381432, 18483177, 18550029, 18614591, 18703630, 18941892, 19064562, 19083124, 19166352, 19221050, 19282383, 19308726, 19439415, 19469636, 19589174, 19630952, 19638208, 19773750, 19931613, 19969081, 20048079, 20072949, 20144226, 20332278, 20534486, 20542113, 20617168, 20835647, 21112394, 21188569, 21231986, 21377485, 21393445, 21420422, 21622727, 21632460, 21658239, 21790896, 22149175, 22576212, 22722193, 22912703, 23041473, 23085504, 23099804, 23129173, 23216985, 23340254, 23518928, 23643682, 23704778, 23846226, 23958744, 24065098, 24119434, 24223121, 24324964, 24402127, 24413080, 24430361, 24496634, 24604139, 24629213, 25088806, 25450981, 25476497, 25689428, 25793413, 25935582, 25962693, 26049585, 26191232, 26345775, 26431176, 26464060, 27029552, 27102200, 27165202, 27228187, 27323034, 27421652, 27502118, 27747906, 27825388, 28112739, 28270386, 28323914, 28429243, 28443693, 29141657, 29189985, 29363090, 29563635, 29701941, 29790386, 29921733, 30409902, 30563991, 30920624, 31477036, 31511352, 31665365, 31757843, 32460723, 32539536, 32823947, 33017027, 33112819, 33902660, 34014013, 34187970, 35320351, 35657638, 36096872, 36418319, 36677847, 36989252, 37049472, 37253812, 37888299, 38122900, 38423186, 40632974, 7556673, 8248245, 8662988	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	18442419, 27323034, 32466779, 35776183, 40571311	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	10755395, 19632843, 23096432, 30850364	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	20688833		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	8248245	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12794759, 16322267, 19555998, 21392519, 8154854, 8686761		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	20835647	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	14580261	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	7856758	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21319151	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21319151, 23930207, 34147074	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	17661084, 20835647, 23756858, 28337664	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	18079323	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27324053, 29303414		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19273201, 20710045, 21320735, 21392519, 22982181, 23669293, 24398390, 28319725, 29233790		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	10755395, 12036409, 22017761, 23096432, 26989051, 29098396		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21614520	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36527059	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15748828, 17894799, 18667686, 23402742, 24410765, 25817828, 27967255, 30921233, 8154854, 8686761		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30297439		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	18310280		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	14715828, 21170323, 26463708, 27561703, 27998966, 30297439		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	21170323, 26463708	Associate	★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	16944977		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	30535957, 31079282		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	31509915		★☆☆☆☆ Found in Text Mining only
Central Precocious Puberty	Central Precocious Puberty	BEFREE	24612204		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	17616393, 19931613, 29701941, 8620462	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33705547	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28964927, 31737354		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	16322267		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	16322267		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30284180		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	30284180, 34871464	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11595503, 11850230, 12050258, 1309352, 16996190, 20043267, 23339036, 30216511, 31509772, 7635140, 8069860, 9528950, 9883986		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	11850230		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	24612204		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28443693		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	22028442		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22843875		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	21479914, 38143338	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17615053, 21479914, 21627810, 23319136, 29066910, 29293897		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17615053, 21479914, 21627810, 25109722, 31724326, 37705049	Associate	★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct disorder	Pubtator	22336992	Associate	★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	11403890		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	28126912, 31070802, 31390647		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30284180		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26562495, 29228596, 30193537, 31509915		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	16045239, 30193537, 35197230	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26562495, 29228596, 30193537, 31509915		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	34128950	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	26562495	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	34128950	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	26562495, 29228596, 30193537, 31509915		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28567535		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	11356692, 22648180, 24705274		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	27145040		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	15748828, 28059101		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18512790, 20417295		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18512790		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30712234, 31321612, 31641936		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28024269, 29054014, 31518674, 31730745		★☆☆☆☆ Found in Text Mining only
Developmental reading disorder	Developmental dyslexia	BEFREE	25877001		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10596729, 16754860, 27289045, 28448463		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10596729, 16754860, 27289045, 28448463, 30679317		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32960117	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32814585	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12690088, 15652721, 27344412, 29339527, 9988276		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27344412, 30970225		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	32814585	Associate	★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	30968679	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	22057025		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	22057025	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	17901908		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysgerminoma	Dysgerminoma	BEFREE	8154854		★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	22426781		★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	40424442	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35511873	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	12690088, 16996190, 24496634	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	17010533		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11216915, 14709152, 15072828, 15608564, 15788666, 15800709, 15800924, 15939586, 16109840, 16730717, 16730930, 17110639, 17167982, 17280616, 17404019, 17507620, 17827443, 18437511, 18508998, 19124504, 19789322, 20053928, 22320986, 22633539, 23873111, 26574572, 27067638, 27923582, 28487654, 28562472, 29182028, 29300901, 29404887, 29584567, 29794673, 29794680, 30217785, 30360364, 31074242, 31130288, 31134155, 31425735, 31509915, 8932332		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Carcinoma	Endometrial carcinoma	GWASCAT_DG	27135401, 30093612		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Diseases	Endometrial Diseases	BEFREE	11850203		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	18467089, 25374239		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	25374239	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11216915, 14631363, 16730717, 17827443, 18437511, 19124504, 19493871, 19509570, 20053928, 22320986, 22633539, 23453006, 23873111, 26574572, 29182028, 34675350, 39401154, 40141105, 7856758, 8932332	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	15072828, 15788666, 16498363, 16730930, 17415442, 17827443, 18437511, 18497059, 19022561, 19124504		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19821643	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	7989490		★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	LHGDN	14631363		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	12161505, 17336977, 17662285, 19401614, 19493871, 20074813, 20655525, 23450050, 24654751, 24968701, 26394174, 30935663, 31119261		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	18815356, 21958689		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10559661, 10593363, 10652502, 10915216, 11045871, 11502834, 11850203, 11925378, 11994385, 12062819, 12161505, 12372439, 12475548, 12620480, 12620485, 12650711, 14747179, 15299092, 15640252, 16024248, 16109840, 16123052, 16564227, 16595205, 16806212, 17112691, 17336977, 17678915, 17687621, 17921479, 18165439, 18559914, 18815356, 18930188, 19001523, 19199093, 19401614, 19493871, 20430378, 20553220, 20586553, 20655525, 21474127, 21958689, 22130322, 22578533, 22759564, 22878119, 23053311, 23139742, 23809139, 24411031, 24654751, 24968701, 25533385, 25767055, 25773531, 26036904, 26058395, 26135543, 26242176, 26530052, 26899323, 27167072, 27320036, 27920344, 28002584, 28286987, 28742579, 29431849, 29559388, 29620427, 29794673, 29794680, 30030390, 30043503, 30328740, 30360364, 30428773, 30965114, 31174438, 31199588, 8550748, 9024261, 9548162, 9851796		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	12620480, 16595205, 17336977, 17678915, 18048499, 18165439, 18335325, 18559914, 18930188, 19001523, 20430378, 20655525, 21958689, 23139742, 23809139, 24411031, 24805834, 24968701, 26242176, 26453052, 27167072, 27833918, 28002584, 28614857, 32416979, 32606145	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	LHGDN	15083380, 16024248, 16566930, 16595205, 17336977, 17678915, 18048499, 19137777		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	17454161, 18815356, 20553220, 21614520	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	18815356, 21958689		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enlarged polycystic ovaries	Enlarged polycystic ovaries	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31737354		★☆☆☆☆ Found in Text Mining only
Epilepsy Partial with Variable Foci	Progressive myoclonic epilepsy	Pubtator	17135033	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15748828, 25817828, 27967255		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	12790781		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	31317572		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	21472143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32487238	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	BEFREE	18274619		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	18274619	Associate	★☆☆☆☆ Found in Text Mining only
Familial Testotoxicosis	Testotoxicosis	BEFREE	29144249, 29654692		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	11929713		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	BEFREE	28341248, 28651157, 30679317		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Female Pseudohermaphroditism	Female Pseudohermaphroditism	BEFREE	9829218		★☆☆☆☆ Found in Text Mining only
Female Pseudohermaphroditism	Female Pseudohermaphroditism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fibroatheroma	Fibroatheroma	BEFREE	11850209		★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	19064562	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	12050211, 12650711, 14747179, 15083381, 17341559, 18182446, 19240151, 22377971, 27252161, 8126151		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	18182446, 18601603		★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	9589695		★☆☆☆☆ Found in Text Mining only
Follicle stimulating hormone deficiency	Follicle Stimulating Hormone Deficiency	BEFREE	15385421		★☆☆☆☆ Found in Text Mining only
Genital Infantilism	Genital Infantilism	CTD_human_DG	8265607		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	16372909		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15364411, 25695958, 28178667		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	15364411		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28178667, 32240464, 34505421	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15364411, 28178667		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19116788, 25695958, 31593305		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32240464	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	31067541	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	31067541	Associate	★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	21188138		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	9745443		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	BEFREE	12736278, 14982857, 16392624, 16452534, 18426832, 21335955, 24037887, 24625355, 25226294, 30052520, 3924954, 9589695		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	LHGDN	16392624, 18426832		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	10652212		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	29536789		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	9745443		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	27289045, 29423705		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	27769104	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure Systolic	Heart failure	Pubtator	30193537	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	11228047, 18559914, 19079715, 20553220, 22057025, 26049585, 35837780	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20835647, 31757843	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	28270386	Stimulate	★☆☆☆☆ Found in Text Mining only
Hermaphroditism	Hermaphroditism	BEFREE	30226860		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	15802318, 20015405, 26199450, 28679622		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	19324338, 20015405, 29630096, 34155264	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28380313		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	21807013, 28980338		★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	22336992	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism 2	Hyperparathyroidism	Pubtator	22963808	Associate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	28988401		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19218192, 21170323, 22104650, 32407592, 32960117	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17893373, 22104650, 26415088, 27602993, 8481338		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18274619		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	35511873	Associate	★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	Pubtator	12736278	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Hypogonadism	BEFREE	15721053, 28679145, 29339527, 31696669		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Hypogonadism	Pubtator	20467160, 26142101, 32499757	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Hypogonadism	CTD_human_DG	9177373		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism, Isolated Hypogonadotropic	Hypogonadism	CTD_human_DG	9177373		★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	20467160		★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	CTD_human_DG	9177373		★☆☆☆☆ Found in Text Mining only
Hypopituitarism	Hypopituitarism	CTD_human_DG	12970278		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias	Hypospadias	BEFREE	22648180, 24705274, 30550360, 31520742		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	32515122	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29720336		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27602993		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	19064562	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	31067541		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	19478482, 20505099, 30587540		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	17336977, 24968701, 27167072, 32960117	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	29325096, 30920624	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	26242176	Associate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	14580261, 27365044, 27900579		★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	17901908, 25159103		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27344412		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	14631363	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	17336977, 18182446, 19240151	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	26367014		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	26367014	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	22405131, 29592948, 29912452		★☆☆☆☆ Found in Text Mining only
Leukocytoclastic vasculitis	Leukocytoclastic Vasculitis	BEFREE	31507048		★☆☆☆☆ Found in Text Mining only
Leydig Cell Tumor	Leydig Cell Tumor	BEFREE	22301800, 2340950		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	27467582, 29104286		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	29770127		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19064581, 19250212, 19331152, 21319151, 23930207, 27289045		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	23930207		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	23930207	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	19331152, 21319151, 9467596		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	21319151	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12451990		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19273201, 19995644, 21320735, 23669293, 36527059	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	21320735, 21392519, 29233790		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20305046		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	28570161		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21188569	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29303414	Stimulate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28024269		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	21289517, 24655565		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	28178667		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10027313, 10465664, 10470147, 10545204, 10598045, 10657957, 10713305, 10713674, 10730684, 10731103, 10731105, 10861475, 10954253, 10956405, 10996432, 11181459, 11245431, 11694352, 11739882, 11745463, 11850205, 11850224, 11897504, 11916235, 11916629, 11935306, 11955795, 12020974, 12095949, 12114443, 12160997, 12204674, 12351690, 12459711, 12514567, 12569569, 12589939, 12605564, 12618873, 12734209, 12839940, 12888106, 12944421, 14566818, 14580261, 14602139, 14623514, 14623517, 14623547, 14633737, 14637391, 14654987, 14979917, 14981949, 15072827, 15126575, 15177662, 15298966, 15328175, 15364411, 15593089, 15623590, 15642171, 15683469, 15687328, 15695411, 15784178, 15831674, 15930283, 15955695, 15964185, 16002280, 16023338, 16024245, 16109840, 16113100, 16170371, 16232327, 16287071, 16303757, 16406421, 16413774, 16480277, 16498361, 16541304, 16556483, 16611627, 16712450, 16740737, 16741831, 16753008, 16755105, 16850246, 16940443, 16954432, 17004113, 17020418, 17047076, 17119036, 17129632, 17215075, 17254854, 17280616, 17315855, 17325027, 17440110, 17555561, 17562079, 17590327, 17616393, 17624762, 17631997, 17657731, 17678531, 17761019, 17875734, 17885619, 17934808, 17975727, 18030614, 18045633, 18049890, 18072234, 18079323, 18199708, 18245543, 18248980, 18271519, 18398027, 18445827, 18483177, 18519709, 18559539, 18592373, 18614276, 18614591, 18629629, 18637488, 18637494, 19013891, 19064562, 19065667, 19082882, 19224856, 19250198, 19250199, 19278756, 19366906, 19439415, 19469636, 19487288, 19509226, 19528477, 19589174, 19638208, 19639193, 19645634, 19755984, 19768880, 19773750, 19883757, 19906814, 19931613, 19943105, 20048079, 20052540, 20054641, 20054642, 20101208, 20133979, 20144226, 20151319, 20205115, 20353934, 20374034, 20386540, 20428938, 20432167, 20497094, 20534486, 20644568, 20697427, 20730598, 20809360, 20817789, 20876420, 20923259, 20960227, 21054398, 21057537, 21112394, 21185724, 21187493, 21187922, 21251330, 21325863, 21332390, 21362200, 21377485, 21392518, 21393445, 21420422, 21431343, 21477609, 21492444, 21494765, 21605624, 21622727, 21658239, 21741436, 21875255, 21939764, 21977969, 22102688, 22128327, 22237979, 22292588, 22300440, 22301800, 22342815, 22350385, 22359603, 22405131, 22407818, 22508516, 22550166, 22576212, 22594760, 22722193, 22723326, 22799738, 22855103, 22906881, 22917634, 22929011, 22939887, 22992372, 23041473, 23090135, 23129173, 23151593, 23160924, 23178495, 23340254, 23342035, 23344024, 23411384, 23493347, 23518928, 23546553, 23566437, 23625277, 23650283, 23652009, 23704778, 23744433, 23780684, 23842740, 23846226, 23869785, 23894347, 23935996, 23958744, 23988612, 24067424, 24074788, 24163427, 24176089, 24223121, 24242068, 24270445, 24324964, 24402127, 24413080, 24430361, 24472707, 24529907, 24590773, 24629213, 24634384, 24836190, 24927687, 24928526, 24929094, 25023195, 25088806, 25159103, 25178514, 25182769, 25193464, 25284587, 25421376, 25421723, 25476497, 25480943, 25500870, 25502281, 25554091, 25588716, 25625755, 25633049, 25634217, 25683269, 25793413, 25837259, 25888249, 25935582, 25962693, 25976679, 25991817, 26026468, 26033800, 26033813, 26049585, 26059638, 26067721, 26108486, 26113604, 26162914, 26165839, 26191232, 26209254, 26252353, 26255816, 26277097, 26345775, 26346768, 26383165, 26455641, 26463708, 26464060, 26658964, 26706698, 26798969, 26923330, 26969395, 27018307, 27029552, 27067638, 27102200, 27113745, 27137076, 27165202, 27177930, 27186656, 27323034, 27333128, 27343990, 27343991, 27365044, 27423512, 27491861, 27502118, 27532743, 27561703, 27570979, 27575547, 27602955, 27616271, 27627986, 27635473, 27659519, 27702664, 27711920, 27747906, 27758888, 27785653, 27793424, 27809310, 27810693, 27825388, 27832985, 27864342, 27900579, 27917746, 27983533, 27998966, 28026901, 28028198, 28045625, 28060751, 28068170, 28083668, 28107349, 28109841, 28112739, 28122888, 28144163, 28148596, 28157646, 28167101, 28174265, 28195993, 28204994, 28229275, 28251384, 28259297, 28267392, 28270386, 28274582, 28319725, 28323914, 28332172, 28337254, 28337664, 28341383, 28346074, 28356008, 28369967, 28384564, 28389808, 28396197, 28403774, 28404691, 28411130, 28412323, 28413771, 28423398, 28429243, 28443693, 28459598, 28467729, 28469437, 28489882, 28512028, 28526959, 28534527, 28535537, 28571770, 28592202, 28611039, 28615284, 28632237, 28635978, 28639029, 28644496, 28651157, 28655486, 28663087, 28669712, 28673637, 28690107, 28691132, 28692125, 28698390, 28742191, 28744736, 28766132, 28770449, 28776988, 28785180, 28792531, 28794284, 28801846, 28821472, 28838227, 28838807, 28877935, 28881223, 28919302, 28922781, 28922787, 28947566, 28969348, 28992264, 29031778, 29039577, 29045530, 29085591, 29090666, 29101597, 29104286, 29116414, 29117210, 29131020, 29131988, 29141657, 29157627, 29168353, 29168427, 29168668, 29202405, 29205077, 29212847, 29233615, 29243101, 29249058, 29274928, 29293897, 29328860, 29329697, 29336269, 29338443, 29343958, 29344249, 29350307, 29363090, 29380528, 29396856, 29401621, 29455298, 29464186, 29470723, 29482983, 29492753, 29501739, 29520506, 29525337, 29527850, 29530940, 29546343, 29572126, 29581979, 29584567, 29620427, 29644889, 29670855, 29681616, 29701941, 29702199, 29719441, 29726787, 29739819, 29747931, 29755596, 29765553, 29769099, 29790386, 29794673, 29794680, 29800559, 29845476, 29847854, 29863451, 29870471, 29890985, 29898754, 29909120, 29912452, 29921733, 29952241, 29963114, 29986672, 29987984, 30012349, 30014974, 30022834, 30036740, 30038708, 30067113, 30077574, 30086432, 30086626, 30094551, 30150428, 30155484, 30159789, 30190660, 30297439, 30299291, 30303924, 30306326, 30316543, 30328006, 30333087, 30379695, 30386297, 30388923, 30410061, 30415752, 30443921, 30474104, 30479694, 30509771, 30513833, 30523459, 30546457, 30561133, 30568462, 30583560, 30591548, 30616553, 30630678, 30658629, 30679317, 30698686, 30709804, 30712236, 30720225, 30742607, 30795951, 30817981, 30822713, 30840336, 30843932, 30868270, 30896247, 30904591, 30920624, 30944027, 30967597, 31011525, 31051411, 31069862, 31079282, 31119683, 31126332, 31127591, 31129450, 31152327, 31190621, 31201904, 31205415, 31211741, 31212043, 31226312, 31235695, 31257015, 31273878, 31292269, 31318068, 31321612, 31327728, 31329454, 31339372, 31342358, 31352137, 31388303, 31393399, 31425735, 31434793, 31440781, 31477036, 31479143, 31479144, 31500470, 31509915, 31511352, 31518632, 31522348, 31522958, 31527321, 31533365, 31546395, 31548345, 31557516, 31568000, 31584741, 31596961, 31598815, 31606823, 31609762, 31610224, 31610271, 31629071, 31630379, 31641936, 31665091, 31665365, 31678641, 31694630, 31741759, 31757843, 31816749, 31839166, 31839281, 31847542, 7581491, 7893351, 7949202, 8043495, 8117355, 8476772, 8662988, 8664162, 8923826, 8943788, 8964875, 8989259, 9010331, 9334290, 9365188, 9365201, 9511180, 9696881, 9797013, 9883986		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	11850205, 19639193, 23342035, 28112739, 29701941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11216915, 15072828, 15608564, 15788666, 15800709, 15800924, 15939586, 16109840, 16730717, 16730930, 17110639, 17167982, 17280616, 17404019, 17507620, 17827443, 18437511, 18508998, 19124504, 20053928, 22320986, 22633539, 23873111, 26574572, 27067638, 28487654, 29182028, 29584567, 29794673, 29794680, 30217785, 30360364, 31074242, 31130288, 31134155, 31425735, 31509915		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28341762		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	9589695		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18508622, 19273201, 21320735, 21392519, 22982181, 23669293, 24398390, 28319725, 29233790		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17624412, 17894799, 18667686, 23402742, 24410765, 30921233, 8686761		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11595700, 16424004, 16498360, 16648498, 17261765, 17482958, 17678531, 17704407, 17911400, 18226472, 18483761, 18491956, 18639541, 19505920, 19789370, 19952760, 21771722, 22549291, 24803183, 26214411, 26921336, 27164191, 29228205, 29803730, 30152543, 30769265, 30904591, 31533365, 8844286, 9496903		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16424004, 17704407		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18595017, 28521442, 31557413		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	12843186, 16551863, 16753042, 19513551		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27324053, 29303414		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10954253, 11476957, 11753649, 11850205, 11850224, 14623514, 15090744, 15126575, 15668497, 15671766, 15748828, 15788666, 15955695, 16303757, 16402077, 16498360, 16940443, 18629629, 18637494, 19026713, 20427689, 21479914, 22342815, 23873111, 25837259, 25955685, 26255816, 27102200, 27145040, 27252161, 28119851, 28144163, 28178667, 28270386, 28554313, 28768532, 28874104, 28877935, 28919302, 29066910, 29090666, 29121167, 29131020, 29328860, 29623577, 29685881, 29729786, 30036740, 30207247, 30613863, 30939535, 31557516, 31679299, 8923826, 9140125, 9467596, 9793759		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	16322267		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	11850205, 19639193, 23342035, 28112739, 29701941		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10690899, 10730684, 10731102, 10731103, 10731105, 11280806, 11795380, 11850205, 11897504, 11973645, 12095949, 12114443, 12160997, 12351690, 12589939, 12846424, 15341993, 15358790, 15525692, 15642164, 15695411, 15955695, 16109788, 16287071, 16498361, 16712450, 16735089, 16997132, 17215075, 17555561, 18079323, 18519709, 18602794, 18614276, 19083124, 19250198, 19250199, 19366906, 19509226, 19800002, 20534486, 22049316, 23493347, 23566437, 23846226, 24669750, 24923427, 24928526, 25023195, 25182769, 25695958, 28396978, 28692125, 29791862, 29793947, 30190660, 30410061, 30479694, 30513833, 30851382, 7893351, 8476772, 8499330, 8989259, 9010331, 9365201, 9449203, 9696881, 9892013		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	11850205, 19639193, 23342035, 28112739, 29701941		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11897504, 11935306, 12351690, 12734209, 12788892, 14973387, 15298966, 15358790, 15862961, 15955695, 16287071, 16406421, 16541304, 16930994, 17119036, 17158756, 17219197, 17562079, 17661084, 17975727, 18030614, 18049890, 18199708, 18245543, 18483177, 18614276, 19064562		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	11850205, 19639193, 23342035, 28112739, 29701941		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	29054014		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27145040		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	BEFREE	30386297		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	31249531		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28024269, 29054014, 31518674, 31730745		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	21289517, 24655565, 29229551		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	34404424	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	21289517, 34404424	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	26049585	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29873201	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30150428, 30152543		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	16648498, 30868236		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	22511967, 28089731		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	22511967	Associate	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	22511967	Associate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	17359589, 19152063		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	28028198		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	17002564	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	22033271		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	21170323	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30297439, 30443921		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30443921		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	21921981	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35633182	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10379885, 10545798, 10598045, 10622415, 10690899, 10713674, 10730684, 10731102, 10731103, 10746939, 10815929, 11158024, 11228047, 11403890, 11708799, 11738552, 11739882, 11935306, 11955795, 12095949, 12114443, 12475548, 12538500, 12589939, 12656667, 12790781, 12796397, 14580261, 14623516, 14633737, 15015704, 15131010, 15328175, 15364411, 15571956, 15671766, 15683469, 15695411, 15748828, 15794932, 15800709, 15831279, 15939586, 15964185, 16002280, 16113100, 16166425, 16170371, 16232327, 16541304, 16551863, 16556483, 16730930, 16740737, 16752221, 16944977, 17088416, 17616392, 17616393, 17695547, 17852420, 18049890, 18079323, 18157729, 18182446, 18197164, 18583996, 18592373, 18629629, 18974231, 19026713, 19224856, 19555998, 19638208, 19800002, 19883757, 19906814, 19931613, 20026603, 20048079, 20133251, 20395670, 20467160, 21325071, 21325863, 21346144, 21392518, 21393445, 21479914, 21511357, 21552322, 21600232, 21939764, 22209285, 22301800, 22377971, 22652558, 22879364, 22929011, 23041473, 23340254, 24410765, 24836190, 25168343, 25625755, 25735362, 25837259, 25994408, 26012644, 26059638, 26113604, 26252353, 26317216, 26346768, 26706698, 27234503, 27324053, 27342400, 27365044, 27602955, 27893427, 28125812, 28163101, 28195993, 28374222, 28423398, 28498441, 28571770, 28660993, 28663087, 28730338, 28766132, 28801307, 29045530, 29234250, 29303414, 29363090, 29563191, 29565450, 29581135, 29736687, 29769550, 30046001, 30067113, 30161001, 30509771, 30742607, 31552220, 31665365, 31721572, 31757843, 31816749, 7581491, 7628871, 7893351, 7989490, 8043495, 8686761, 8735608, 8923826, 8989259, 9365188, 9449203, 9467596, 9500452, 9589695, 9696881, 9730607, 9768687, 9793759, 9797013		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	BEFREE	29104286		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	19001523, 28125812, 28176175		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29843142, 31593305		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27298742, 27702664		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	27289045		★☆☆☆☆ Found in Text Mining only
Neuronal heterotopia	Neuronal Heterotopia	BEFREE	22426781		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	31839149		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30679317		★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	28100869		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19273201, 19930708, 20710045, 21320735, 21392519, 21511357, 21600232, 22658344, 22982181, 22985911, 25310221, 25564397, 27234503		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	18079323, 18310280, 20179229, 24874483, 26768485, 27780311, 28650276, 28685613		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12690088, 16894362, 19509226, 20004389, 20881004, 21198743, 21622727, 22106445, 22128327, 22464085, 22576212, 23880231, 23958744, 24163427, 24866503, 25634217, 26113604, 26209254, 27423512, 27886379, 28270386, 28679145, 28919302, 28948418, 29104286, 29222346, 29415446, 29453232, 30046001, 30232779, 30388923, 30562161, 30679317, 30920624, 31002529		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	12690088, 16418790, 19124504, 19221050, 20004389, 21198743, 21622727, 22106445, 22464085, 23041473, 23958744, 25476497, 28323914, 30409902, 30920624, 32499757, 34983051	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19347708, 21622727, 22576212, 28270386	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23099804	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	12690088	Associate	★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	BEFREE	21477611		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	21477611		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	14602139, 14623516, 15358790, 15860267, 16480277, 17158758, 17315855, 17942301, 18271519, 18445827, 18820009, 19061505, 19190349, 19906814, 20133251, 20697068, 21325071, 21420993, 21431343, 21477608, 21658239, 22128327, 22209285, 22237979, 22456984, 22843875, 23280127, 23493347, 23518928, 23643682, 24118529, 24242068, 24472707, 24634384, 24670685, 25634217, 25667100, 25837259, 25849966, 26026468, 26049585, 26113056, 26503812, 26585578, 26681738, 26795347, 27246191, 27253864, 27532743, 27548161, 27602955, 27802892, 27827358, 28324268, 28346074, 28403774, 28438054, 28489562, 28526959, 28529550, 28612226, 28643023, 28681171, 28766132, 28801846, 29071491, 29141657, 29202405, 29212847, 29326029, 29363090, 29507656, 29804490, 29805747, 30036740, 30080878, 30171625, 30458882, 30648747, 30897853, 30939535, 30967597, 31002529, 31318440, 31393200, 31465093, 31479144, 31733346, 31780604		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	18512790	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	20417295, 22170453	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Hip	Osteoarthritis	Pubtator	20417295	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	20417295	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	11092403, 11344237, 11730247, 12843146, 14517714, 15794932, 16357189, 18614276, 21874760, 23643682, 26049585, 26086567, 26108486, 28396197, 28403774, 28838807, 28955236, 29073497, 29116414, 29520506, 29572126, 29741296, 29981903, 30022834, 30222369, 30223134, 30474104, 30855728, 30939140, 31127467, 31318068, 31352137, 31694630		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	10750565, 11360662, 14517714, 14715870, 15126575, 15794932, 16530497, 17002564, 17118999, 17215075, 17391072, 19906814, 21948762, 25023195, 26086567, 27983533, 28464211, 29329467, 29520506, 29546647, 29559791, 29794673, 29794680, 29981903, 30036740, 30413856, 30519756, 30795951, 30855728, 30939140, 31172521, 31393399, 31596961, 7626449		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	LHGDN	14715870, 17391072		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	15613678, 16418790, 17002564, 17118999, 30855728	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	CTD_human_DG	20723554		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis Postmenopausal	Osteoporosis	Pubtator	37253812	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis, Age-Related	Osteoporosis	BEFREE	15181061		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	20723554		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	17118999, 29329467		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	20723554		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19906814, 29039776		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	8686761		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	BEFREE	15748828, 19844120		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	32606145	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian Diseases	CTD_human_DG	11985600		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Diseases	Ovarian diseases	Pubtator	16566930, 31878927	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Failure, Premature	Ovarian Failure	BEFREE	20797716, 21269619, 21505076, 30525588, 31692519		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Granulosa Cell Tumor	Ovarian Tumor	BEFREE	21188138		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	18159088, 28345956, 29206944		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17894799, 18667686, 23402742, 24410765, 30921233, 8686761		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18497059, 18667686		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18667686, 26526982, 26576867, 27086564, 29157627, 29553041, 32590918, 33273524, 8686761	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19156774		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	21477611, 29862427		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	16940443		★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	22648180, 24705274, 30550360, 31520742		★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	11403890, 16452534, 16944977, 24037887, 30052520		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	31315571		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	12215320, 19324338, 20015405, 23461365, 24649863, 25374239, 27187585, 28944702, 29050673, 29564739, 29630096, 31276164, 32651991, 32960117, 34001150, 34155264, 34233642, 34939397, 36932437, 39294274, 40065436, 8265607	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	15695318, 15802318, 16473000, 18467089, 18505907, 19324338, 20015405, 21282199, 21807013, 21972004, 22889864, 23461365, 23661022, 24157654, 25130462, 25374239, 26199450, 27187585, 27790765, 27927075, 28345956, 28875319, 29050673, 29397057, 29471436, 29564739, 29797697, 30012349, 30287740, 30477916, 30871463, 30988730, 31185267, 31276164, 31296604, 31360184, 31421163, 31735954, 8200927, 8265607, 9147642, 9510005		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	15695318, 18505907		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21262361, 22381227, 8265607, 9177373		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	20723554		★☆☆☆☆ Found in Text Mining only
Precocious pubarche	Precocious Pubarche	BEFREE	15802318, 16473000		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	10731123, 25159103		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	20797716, 21269619, 30525588		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30712234, 31321612, 31641936		★☆☆☆☆ Found in Text Mining only
Primary hypogonadism	Hypogonadism	CTD_human_DG	9177373		★☆☆☆☆ Found in Text Mining only
Primary hypogonadism	Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	BEFREE	26279340		★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	HPO_DG			★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	29104246		★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	14981949		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11571725, 11595700, 14508827, 16424004, 16498360, 16648498, 17261765, 17482958, 17678531, 17704407, 17911400, 18226472, 18483761, 18491956, 18639541, 19505920, 19789370, 19952760, 21771722, 22549291, 22731640, 24803183, 26214411, 26921336, 27164191, 29228205, 29803730, 30152543, 30769265, 30904591, 31533365, 8844286, 9140125, 9496903		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	16498360		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	12370109		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	19921206, 29873201, 35672281, 39806744, 8844286	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16424004, 17704407		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16498360, 17482958, 18483761, 19107851		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19789370, 21106711, 21771722, 22549291, 26214411, 27164191, 27513235, 27610593, 29228205, 33451122, 8620462, 8844286	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	BEFREE	29121167		★☆☆☆☆ Found in Text Mining only
Pseudohermaphroditism	Pseudohermaphroditism	BEFREE	9829218		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21479914		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10446859, 19555469		★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	14631363	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19597801		★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21262361, 22381227, 8265607, 9177373		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16372909		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	16372909	Associate	★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	21921981		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	26279340, 29357278		★☆☆☆☆ Found in Text Mining only
Sexual Dysfunction	Sexual Dysfunction	BEFREE	28229275, 28635978, 31342358		★☆☆☆☆ Found in Text Mining only
Sexual Infantilism	Sexual Infantilism	CTD_human_DG	8265607		★☆☆☆☆ Found in Text Mining only
Sheehan Syndrome	Sheehan Syndrome	CTD_human_DG	12970278		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	19298523	Associate	★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	17901908, 25159103		★☆☆☆☆ Found in Text Mining only
Spondylocostal dysostosis autosomal recessive	Spondylocostal dysostosis	Pubtator	15613678	Associate	★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29665500		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	11929713		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28341248, 28651157, 30679317		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18595017, 28521442, 31557413		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19015200, 23110082, 27893427, 31557413, 37784135	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21170323	Associate	★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	28333207		★☆☆☆☆ Found in Text Mining only
Subfertility, Female	Subfertility	CTD_human_DG	14684609		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	28553748, 30915263		★☆☆☆☆ Found in Text Mining only
Testicular Feminization	Testicular Feminization	BEFREE	17852420		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	22402210		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	17852420		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	17852420, 22301800	Associate	★☆☆☆☆ Found in Text Mining only
Testotoxicosis	Testotoxicosis	BEFREE	16361981		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	15237001	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12481941, 12547722, 12843186, 16551863, 16753042, 18571834, 19513551		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	18958156	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	12843186, 15231710, 15623821, 16551863, 16753042, 18571834, 19513551		★☆☆☆☆ Found in Text Mining only
TOE SYNDACTYLY, TELECANTHUS, AND ANOGENITAL AND RENAL MALFORMATIONS	Toe Syndactyly, Telecanthus, And Anogenital And Renal Malformations	BEFREE	28666831, 30925464		★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	BEFREE	29720397, 30698686		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	8908530, 9147642		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23643682, 26049585	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27848152		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36902090	Inhibit	★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	22033271		★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	12656667		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	25159103		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27324053, 29303414	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine Diseases	LHGDN	11850203		★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine Diseases	BEFREE	16024248, 16109840		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	12050211, 12650711, 14747179, 15083381, 16024248, 17341559, 18182446, 18601603, 19240151, 22377971, 27252161, 8126151		★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	20045626		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30297439		★☆☆☆☆ Found in Text Mining only
Vasculitis, Leukocytoclastic, Cutaneous	Vasculitis	BEFREE	31507048		★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	19821643	Inhibit	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	29720397		★☆☆☆☆ Found in Text Mining only