TMEM74 (transmembrane protein 74)

Gene

• Entrez ID: 157753
• Gene name: Transmembrane protein 74
• Gene symbol: TMEM74
• Synonyms (NCBI Gene): NET36
• Chromosome: 8
• Chromosome location: 8q23.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023244	hsa-miR-122-5p	Microarray	17612493
MIRT1439088	hsa-miR-570	CLIP-seq
MIRT1439089	hsa-miR-607	CLIP-seq
MIRT2131503	hsa-miR-376c	CLIP-seq
MIRT2131504	hsa-miR-4789-3p	CLIP-seq
MIRT2352774	hsa-miR-3129-3p	CLIP-seq
MIRT2352775	hsa-miR-4735-5p	CLIP-seq
MIRT2352776	hsa-miR-579	CLIP-seq
MIRT2352777	hsa-miR-617	CLIP-seq
MIRT2396054	hsa-miR-576-3p	CLIP-seq
MIRT2646434	hsa-miR-3163	CLIP-seq
MIRT2646435	hsa-miR-340	CLIP-seq
MIRT2646436	hsa-miR-3662	CLIP-seq
MIRT2646437	hsa-miR-3714	CLIP-seq
MIRT2646438	hsa-miR-4480	CLIP-seq
MIRT2646439	hsa-miR-4771	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000421	Component	Autophagosome membrane	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006914	Process	Autophagy	IEA
GO:0016020	Component	Membrane	IEA
GO:0016236	Process	Macroautophagy	IMP	18294959
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0051867	Process	General adaptation syndrome, behavioral process	IEA

Other IDs

• MIM: 613935
• HGNC: 26409
• e!Ensembl: ENSG00000164841

Protein

• UniProt ID: Q96NL1
• Protein name: Transmembrane protein 74
• Protein function: Plays an essential role in autophagy. TMEM74-induced autophagy may involve PI3K signal transduction.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14927	Neurensin	142 → 269		Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, lung, and placenta. {ECO:0000269|PubMed:18294959}.
• Sequence:

  MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKL
  SSSPASPSSSLQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINL
  EQRNRSSPSAKGHNHPGELGWENPNEWSQEAAISLISEEEDDTSSEATSSGKSIDYGFIS
  AILFLVTGILLVIISYIVPREVTVDPNTVAAREMERLEKESARLGAHLDRCVIAGLCLLT
  LGGVILSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNFRMKTSTNENTLELSLVEEDA
  LAVQS

• Sequence length: 305

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL NEOVASCULARIZATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE INFERTILITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE MYOCLONIC EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alopecia	Alopecia	GWASCAT_DG	28196072		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	40644891	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34746309	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29629952		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29629952		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29629952		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29629952		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29048433, 29629952		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29048433		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	33236465	Associate	★☆☆☆☆ Found in Text Mining only