CYP3A5 (cytochrome P450 family 3 subfamily A member 5)

Gene

• Entrez ID: 1577
• Gene name: Cytochrome P450 family 3 subfamily A member 5
• Gene symbol: CYP3A5
• Synonyms (NCBI Gene): CP35, CYPIIIA5, P450PCN3, PCN3
• Chromosome: 7
• Chromosome location: 7q22.1
• Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The encoded protei

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017425	hsa-miR-335-5p	Microarray	18185580
MIRT718062	hsa-miR-4438	HITS-CLIP	19536157
MIRT718061	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT718060	hsa-miR-2115-5p	HITS-CLIP	19536157
MIRT718059	hsa-miR-516a-3p	HITS-CLIP	19536157
MIRT718058	hsa-miR-516b-3p	HITS-CLIP	19536157
MIRT718057	hsa-miR-7162-5p	HITS-CLIP	19536157
MIRT718056	hsa-miR-3191-5p	HITS-CLIP	19536157
MIRT718055	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT718054	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT718053	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT449882	hsa-miR-3690	PAR-CLIP	22100165
MIRT449881	hsa-miR-4254	PAR-CLIP	22100165
MIRT449880	hsa-miR-504-3p	PAR-CLIP	22100165
MIRT449879	hsa-miR-122-5p	PAR-CLIP	22100165
MIRT449878	hsa-miR-3161	PAR-CLIP	22100165
MIRT449877	hsa-miR-599	PAR-CLIP	22100165
MIRT735100	hsa-miR-500a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31955224
MIRT718062	hsa-miR-4438	HITS-CLIP	19536157
MIRT718061	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT718060	hsa-miR-2115-5p	HITS-CLIP	19536157
MIRT718059	hsa-miR-516a-3p	HITS-CLIP	19536157
MIRT718058	hsa-miR-516b-3p	HITS-CLIP	19536157
MIRT718057	hsa-miR-7162-5p	HITS-CLIP	19536157
MIRT718056	hsa-miR-3191-5p	HITS-CLIP	19536157
MIRT718055	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT718054	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT718053	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT449882	hsa-miR-3690	PAR-CLIP	22100165
MIRT449881	hsa-miR-4254	PAR-CLIP	22100165
MIRT449880	hsa-miR-504-3p	PAR-CLIP	22100165
MIRT449879	hsa-miR-122-5p	PAR-CLIP	22100165
MIRT449878	hsa-miR-3161	PAR-CLIP	22100165
MIRT449877	hsa-miR-599	PAR-CLIP	22100165
MIRT1547821	hsa-miR-128	CLIP-seq
MIRT1547822	hsa-miR-140-3p	CLIP-seq
MIRT1547823	hsa-miR-197	CLIP-seq
MIRT1547824	hsa-miR-28-3p	CLIP-seq
MIRT1547825	hsa-miR-4302	CLIP-seq
MIRT1547821	hsa-miR-128	CLIP-seq
MIRT1547822	hsa-miR-140-3p	CLIP-seq
MIRT1547823	hsa-miR-197	CLIP-seq
MIRT1547824	hsa-miR-28-3p	CLIP-seq
MIRT1547825	hsa-miR-4302	CLIP-seq
MIRT2447925	hsa-miR-3908	CLIP-seq
MIRT2447926	hsa-miR-410	CLIP-seq
MIRT2447927	hsa-miR-618	CLIP-seq
MIRT2512491	hsa-miR-338-5p	CLIP-seq
MIRT2512492	hsa-miR-4633-5p	CLIP-seq
MIRT2512493	hsa-miR-4694-5p	CLIP-seq
MIRT2512494	hsa-miR-4698	CLIP-seq
MIRT2512495	hsa-miR-522	CLIP-seq
MIRT2512496	hsa-miR-532-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Unknown	11485307
SP3	Unknown	11485307
VDR	Unknown	22939842
YY1	Unknown	22292071

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002933	Process	Lipid hydroxylation	IDA	14559847
GO:0002933	Process	Lipid hydroxylation	IEA
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	ISS
GO:0004497	Function	Monooxygenase activity	TAS	2732228
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008202	Process	Steroid metabolic process	IBA
GO:0008202	Process	Steroid metabolic process	IDA	14559847
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008202	Process	Steroid metabolic process	TAS	2732228
GO:0008210	Process	Estrogen metabolic process	IDA	12865317
GO:0008210	Process	Estrogen metabolic process	IEA
GO:0008401	Function	Retinoic acid 4-hydroxylase activity	IDA	11093772
GO:0008401	Function	Retinoic acid 4-hydroxylase activity	IEA
GO:0009822	Process	Alkaloid catabolic process	IDA	15039299
GO:0009822	Process	Alkaloid catabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IDA	15039299
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0019825	Function	Oxygen binding	IEA
GO:0019825	Function	Oxygen binding	TAS	2732228
GO:0020037	Function	Heme binding	IEA
GO:0042178	Process	Xenobiotic catabolic process	IDA	15039299
GO:0042178	Process	Xenobiotic catabolic process	IEA
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042573	Process	Retinoic acid metabolic process	IDA	11093772
GO:0042573	Process	Retinoic acid metabolic process	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	TAS	2732228
GO:0046222	Process	Aflatoxin metabolic process	IEA
GO:0046222	Process	Aflatoxin metabolic process	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0050649	Function	Testosterone 6-beta-hydroxylase activity	IBA
GO:0050649	Function	Testosterone 6-beta-hydroxylase activity	IEA
GO:0070989	Process	Oxidative demethylation	IBA
GO:0070989	Process	Oxidative demethylation	IDA	15039299
GO:0070989	Process	Oxidative demethylation	IEA
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IBA
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IDA	14559847
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IEA
GO:0101021	Function	Estrogen 2-hydroxylase activity	IEA

Other IDs

• MIM: 605325
• HGNC: 2638
• e!Ensembl: ENSG00000106258

Protein

• UniProt ID: P20815
• Protein name: Cytochrome P450 3A5 (EC 1.14.14.1) (CYPIIIA5) (Cytochrome P450-PCN3)
• Protein function: A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and vitamins (PubMed:10681376, PubMed:11093772, PubMed:12865317, PubMed:2732228). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, a
• PDB: 5VEU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	38 → 492	Cytochrome P450	Domain

• Sequence:

  MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKF
  DTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISL
  AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYS
  MDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSL
  FPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSI
  IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVV
  NETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS
  KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG
  LLQPEKPIVLKVDSRDGTLSGE

• Sequence length: 502

Pathways

KEGG:

Steroid hormone biosynthesis
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis - DNA adducts

Reactome:

Xenobiotics
Aflatoxin activation and detoxification

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYP3A5-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential hypertension	not provided	ClinVar CTD, Disgenet CTD, Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Familial pancreatic carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension, salt-sensitive essential, susceptibility to	association; drug response; risk factor	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
refractory myasthenia gravis	association; drug response; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA AND RELATED DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tacrolimus response	association; drug response; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	31102151		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	30808393		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	28440407		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12439220, 12846892, 19467705, 21225912, 21418106, 25266680, 25673168, 29970035		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28381170		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16281975		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12439220, 19467705, 21418106, 25266680, 25673168, 29970035		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	30320358		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28248857		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26855150		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	34523245	Inhibit	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18248681, 29535503		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28324194	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23290512		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18248681		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28678049		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29375701		★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	15708542		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	17979523, 18566991		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28676933		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	16754899, 26961113	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15596297, 16361630, 16430309, 19229255, 22938436, 9485019		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22938436, 23143606, 32351149, 32456253	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	437913		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12822676, 25024626, 27203676, 35099304	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28676933		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12822676, 14515059, 1820735, 18409147, 1844821, 24085358, 437913, 540021, 876325, 9731718		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37920921	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17373732	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21702053		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31064695		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	39459499	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	37247449	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	24368493		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	24368493, 25534367		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12439220, 19467705, 21418106, 22215203, 25084203, 25266680, 25673168, 29970035		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	30320358		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	26773964		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	17700595, 25014506		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	18496128, 24535486		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	29113387		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32570960, 33886687	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23584898, 30881507		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17615053, 25934339	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31652395		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	24352002, 26184414		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22015057		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24763934, 25112801		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24763934, 25112801		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24763934, 25112801		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	23385102		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	34435592	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	34523245	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21206424, 29621269	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26961113		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29439084	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36734157	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22837373, 29723426		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	31770256	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	23984379, 24384557, 26421491, 27498208, 31564953		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	32029960	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17373732, 23358850	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	CTD_human_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	17264302	Associate	★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	17701008		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	31770256	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	22445700		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	36139147	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	26325438	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31652395		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	31652395	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	39459499	Associate	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	34117631	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	18727922, 22120734, 23252946, 23501331		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	35839255	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25966085	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	12754175, 15492926, 18248681, 21851254, 25966085, 28448186, 33633318, 36897672, 36982571	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	12754175, 15596575		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15596575, 15952872, 16822233, 17339868, 18248681, 18496130, 19290795, 19907160, 20617557, 21814220, 21851254, 23324949, 23863802, 24338455, 27334520, 28448186, 30861159		★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	19907160		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30320358	Inhibit	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	31773688	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	31652395	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25534367, 31064695		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	25151207		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	18408564, 20526235		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	19907160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	25966085, 33633318	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure Chronic	Kidney failure	Pubtator	26773964	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	17700595, 27217047		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	26773964		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	21380731		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16188140		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19823770		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25992585, 28440407	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	18930278, 19332043, 22271208, 23143606, 24704000, 26179145		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12822676, 15454734, 25649767, 31588878		★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	24104197	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12822676, 31588878		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12822676, 1336722, 24085358, 32350633	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	28324194	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28324194, 31755126		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	26189776		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15596297, 16361630, 16430309, 19229255, 22938436, 28178648, 9485019		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	15978331, 16272171		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	17605821		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12822676, 14515059, 1820735, 18409147, 1844821, 24085358, 437913, 540021, 876325, 9731718		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21702053		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14504207, 15548719, 15876487, 16430309, 17116727, 17914095, 18306354, 24989928, 29970707		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	18306354		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	20345875		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28676933		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12846892, 15179407, 15228172, 16243813, 16430309, 19376514, 21209234, 21658147, 23327575, 23584898, 24989928, 25649767, 26018448, 26855150, 27236640, 28697165, 29115708, 437913, 540021		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	20345875		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11767004		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	20617557		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	30320358		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	30320358	Associate	★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	31770256		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	16160620		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27010496		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36581339	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	29232479	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	29611886		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11836601		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	11836601		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	11836601		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21039054, 23272163, 23394475, 27426203, 28330783, 28367681, 29427770		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	26626639	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	21142270		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15596297, 15897249, 16281975, 18306354, 24699256, 25526449, 25649767, 26855150, 28404946, 29774122, 30881507		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	25151207		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	29615122, 29637588	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29637588		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25370902		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	21225912, 26179145, 29115708		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	21702053, 23143606	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	22271208, 23143606, 24704000, 26179145		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17450472		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22299599, 35110472	Associate	★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	18768491		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21702053		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26855150		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31559607		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	12846892, 25084203, 26565076		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	12846892, 21225912	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	12846892, 25084203, 26565076		★☆☆☆☆ Found in Text Mining only
Porphyria Acute Intermittent	Porphyria	Pubtator	30808393	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	21225912		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14504207, 15548719, 15876487, 16430309, 17116727, 17914095, 18306354, 24989928, 29970707		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15876487, 17914095, 18306354		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	18306354		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21493872, 34570813, 36688864, 37924098	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	35879888	Associate	★☆☆☆☆ Found in Text Mining only
Protoporphyria Erythropoietic	Erythropoietic protoporphyria	Pubtator	36952646	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22015057		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	25521359		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	18408564, 22743729, 26189776		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	22445700		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	22445700		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	22445700		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25817604, 28324194		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	25670065	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18551040, 19591893		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18551040		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18551040, 19591893, 21142916		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia and related disorders	Schizophrenia	BEFREE	21142916		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia and related disorders	Schizophrenia	PSYGENET_DG	21142916		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	25934339		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	29113387		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16430309		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16272171, 17373732		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17373732, 23358850		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18254958	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31322243	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	37247449	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21289623, 24033383, 27717793, 29842871		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	12822676	Associate	★☆☆☆☆ Found in Text Mining only