CYP3A4 (cytochrome P450 family 3 subfamily A member 4)

Gene

• Entrez ID: 1576
• Gene name: Cytochrome P450 family 3 subfamily A member 4
• Gene symbol: CYP3A4
• Synonyms (NCBI Gene): CP33, CP34, CYP3A, CYP3A3, CYPIIIA3, CYPIIIA4, HLP, NF-25, P450C3, P450PCN1, VDDR3
• Chromosome: 7
• Chromosome location: 7q22.1
• Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein locali

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs2740574	C>A,G,T	Drug-response, benign	Upstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006510	hsa-miR-27b-3p	Immunoblot, Luciferase reporter assay	19581388
MIRT006510	hsa-miR-27b-3p	Immunoblot, Luciferase reporter assay	19581388
MIRT921473	hsa-miR-1	CLIP-seq
MIRT921474	hsa-miR-106a	CLIP-seq
MIRT921475	hsa-miR-106b	CLIP-seq
MIRT921476	hsa-miR-1185	CLIP-seq
MIRT921477	hsa-miR-1224-5p	CLIP-seq
MIRT921478	hsa-miR-1262	CLIP-seq
MIRT921479	hsa-miR-1304	CLIP-seq
MIRT921480	hsa-miR-17	CLIP-seq
MIRT921481	hsa-miR-206	CLIP-seq
MIRT921482	hsa-miR-20a	CLIP-seq
MIRT921483	hsa-miR-20b	CLIP-seq
MIRT921484	hsa-miR-2117	CLIP-seq
MIRT921485	hsa-miR-2392	CLIP-seq
MIRT921486	hsa-miR-326	CLIP-seq
MIRT921487	hsa-miR-330-5p	CLIP-seq
MIRT921488	hsa-miR-3545-3p	CLIP-seq
MIRT921489	hsa-miR-3545-5p	CLIP-seq
MIRT921490	hsa-miR-3605-5p	CLIP-seq
MIRT921491	hsa-miR-3609	CLIP-seq
MIRT921492	hsa-miR-3673	CLIP-seq
MIRT921493	hsa-miR-3679-5p	CLIP-seq
MIRT921494	hsa-miR-3915	CLIP-seq
MIRT921495	hsa-miR-4259	CLIP-seq
MIRT921496	hsa-miR-4273	CLIP-seq
MIRT921497	hsa-miR-4299	CLIP-seq
MIRT921498	hsa-miR-431	CLIP-seq
MIRT921499	hsa-miR-4455	CLIP-seq
MIRT921500	hsa-miR-4456	CLIP-seq
MIRT921501	hsa-miR-4635	CLIP-seq
MIRT921502	hsa-miR-4680-5p	CLIP-seq
MIRT921503	hsa-miR-4689	CLIP-seq
MIRT921504	hsa-miR-4694-5p	CLIP-seq
MIRT921505	hsa-miR-4699-3p	CLIP-seq
MIRT921506	hsa-miR-4701-3p	CLIP-seq
MIRT921507	hsa-miR-4717-5p	CLIP-seq
MIRT921508	hsa-miR-4755-3p	CLIP-seq
MIRT921509	hsa-miR-4796-3p	CLIP-seq
MIRT921510	hsa-miR-511	CLIP-seq
MIRT921511	hsa-miR-519d	CLIP-seq
MIRT921512	hsa-miR-548a-5p	CLIP-seq
MIRT921513	hsa-miR-548ab	CLIP-seq
MIRT921514	hsa-miR-548ah	CLIP-seq
MIRT921515	hsa-miR-548ak	CLIP-seq
MIRT921516	hsa-miR-548b-5p	CLIP-seq
MIRT921517	hsa-miR-548c-5p	CLIP-seq
MIRT921518	hsa-miR-548d-5p	CLIP-seq
MIRT921519	hsa-miR-548h	CLIP-seq
MIRT921520	hsa-miR-548i	CLIP-seq
MIRT921521	hsa-miR-548j	CLIP-seq
MIRT921522	hsa-miR-548q	CLIP-seq
MIRT921523	hsa-miR-548w	CLIP-seq
MIRT921524	hsa-miR-548y	CLIP-seq
MIRT921525	hsa-miR-559	CLIP-seq
MIRT921526	hsa-miR-593	CLIP-seq
MIRT921527	hsa-miR-609	CLIP-seq
MIRT921528	hsa-miR-613	CLIP-seq
MIRT921529	hsa-miR-659	CLIP-seq
MIRT921530	hsa-miR-93	CLIP-seq
MIRT921531	hsa-miR-133a	CLIP-seq
MIRT921532	hsa-miR-133b	CLIP-seq
MIRT921533	hsa-miR-342-3p	CLIP-seq
MIRT921488	hsa-miR-3545-3p	CLIP-seq
MIRT921534	hsa-miR-3937	CLIP-seq
MIRT921498	hsa-miR-431	CLIP-seq
MIRT921501	hsa-miR-4635	CLIP-seq
MIRT921502	hsa-miR-4680-5p	CLIP-seq
MIRT921510	hsa-miR-511	CLIP-seq
MIRT921535	hsa-miR-941	CLIP-seq
MIRT1973029	hsa-miR-122	CLIP-seq
MIRT1973030	hsa-miR-1912	CLIP-seq
MIRT1973031	hsa-miR-216a	CLIP-seq
MIRT1973032	hsa-miR-4463	CLIP-seq
MIRT1973033	hsa-miR-4494	CLIP-seq
MIRT2208678	hsa-miR-1229	CLIP-seq
MIRT2208679	hsa-miR-1253	CLIP-seq
MIRT2208680	hsa-miR-150	CLIP-seq
MIRT1973030	hsa-miR-1912	CLIP-seq
MIRT2208681	hsa-miR-2114	CLIP-seq
MIRT2208682	hsa-miR-24	CLIP-seq
MIRT2208683	hsa-miR-2467-3p	CLIP-seq
MIRT2208684	hsa-miR-3159	CLIP-seq
MIRT2208685	hsa-miR-4438	CLIP-seq
MIRT1973032	hsa-miR-4463	CLIP-seq
MIRT1973033	hsa-miR-4494	CLIP-seq
MIRT2208686	hsa-miR-5095	CLIP-seq
MIRT921535	hsa-miR-941	CLIP-seq
MIRT1973029	hsa-miR-122	CLIP-seq
MIRT2208678	hsa-miR-1229	CLIP-seq
MIRT1973030	hsa-miR-1912	CLIP-seq
MIRT1973031	hsa-miR-216a	CLIP-seq
MIRT2386669	hsa-miR-3168	CLIP-seq
MIRT1973032	hsa-miR-4463	CLIP-seq
MIRT1973033	hsa-miR-4494	CLIP-seq
MIRT1973029	hsa-miR-122	CLIP-seq
MIRT2208678	hsa-miR-1229	CLIP-seq
MIRT1973030	hsa-miR-1912	CLIP-seq
MIRT1973031	hsa-miR-216a	CLIP-seq
MIRT2512488	hsa-miR-3135	CLIP-seq
MIRT1973032	hsa-miR-4463	CLIP-seq
MIRT1973033	hsa-miR-4494	CLIP-seq
MIRT2512489	hsa-miR-4735-5p	CLIP-seq
MIRT2512490	hsa-miR-599	CLIP-seq
MIRT1973029	hsa-miR-122	CLIP-seq
MIRT1973030	hsa-miR-1912	CLIP-seq
MIRT2512488	hsa-miR-3135	CLIP-seq
MIRT1973032	hsa-miR-4463	CLIP-seq
MIRT1973033	hsa-miR-4494	CLIP-seq
MIRT2512489	hsa-miR-4735-5p	CLIP-seq
MIRT2512490	hsa-miR-599	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Unknown	15100175
DBP	Activation	18004209
FOXA3	Unknown	19706729
FOXM1	Unknown	15100175
HDAC1	Unknown	21996064
HNF4A	Unknown	12514743
MYC	Unknown	14575816
NCOA6	Unknown	21292004
NR1I2	Activation	12601364;15269186;18540626;19232333;21342487
NR1I2	Unknown	11991950;12606758;15100175;15650019;16608838;18096673;20171174;21292004;21920351;23807564
RELA	Unknown	16608838
RXRA	Unknown	16608838;18400206
SP1	Unknown	15100175
VDR	Unknown	11723248
VDR	Activation	12147248;19712670
VDR	Unknown	11991950;15205382;15358113;18400206;22939842

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002933	Process	Lipid hydroxylation	IDA	14559847
GO:0002933	Process	Lipid hydroxylation	IEA
GO:0004497	Function	Monooxygenase activity	IDA	15327587
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	ISS
GO:0004497	Function	Monooxygenase activity	TAS	2492107
GO:0005496	Function	Steroid binding	IDA	15256616
GO:0005506	Function	Iron ion binding	IDA	15256616
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	26988023, 32814053
GO:0005737	Component	Cytoplasm	IDA	18446064
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	TAS	2492107
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006694	Process	Steroid biosynthetic process	IEA
GO:0006706	Process	Steroid catabolic process	IMP	18356043
GO:0006805	Process	Xenobiotic metabolic process	IDA	19219744
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008202	Process	Steroid metabolic process	IBA
GO:0008202	Process	Steroid metabolic process	IDA	14559847
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008202	Process	Steroid metabolic process	IMP	3259858
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008209	Process	Androgen metabolic process	TAS	19651758
GO:0008210	Process	Estrogen metabolic process	IDA	11555828, 12865317, 14559847
GO:0008210	Process	Estrogen metabolic process	IEA
GO:0008395	Function	Steroid hydroxylase activity	IMP	18356043
GO:0008395	Function	Steroid hydroxylase activity	TAS
GO:0008401	Function	Retinoic acid 4-hydroxylase activity	IDA	11093772
GO:0008401	Function	Retinoic acid 4-hydroxylase activity	IEA
GO:0009822	Process	Alkaloid catabolic process	IDA	15039299
GO:0009822	Process	Alkaloid catabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016098	Process	Monoterpenoid metabolic process	IDA	16401082
GO:0016491	Function	Oxidoreductase activity	IDA	15039299, 16401082, 19219744
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0019825	Function	Oxygen binding	IEA
GO:0019825	Function	Oxygen binding	TAS	2492107, 3460094
GO:0019899	Function	Enzyme binding	IPI	15680923
GO:0020037	Function	Heme binding	IEA
GO:0030343	Function	Vitamin D3 25-hydroxylase activity	IDA	15546903
GO:0034875	Function	Caffeine oxidase activity	IDA	18619574
GO:0036378	Process	Calcitriol biosynthetic process from calciol	IEA
GO:0042178	Process	Xenobiotic catabolic process	IDA	15039299, 15327587, 18619574
GO:0042178	Process	Xenobiotic catabolic process	IEA
GO:0042178	Process	Xenobiotic catabolic process	IMP	18356043
GO:0042359	Process	Vitamin D metabolic process	IDA	15546903
GO:0042369	Process	Vitamin D catabolic process	IDA	29461981
GO:0042572	Process	Retinol metabolic process	IDA	10681376
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042573	Process	Retinoic acid metabolic process	IDA	11093772
GO:0042573	Process	Retinoic acid metabolic process	IEA
GO:0042759	Process	Long-chain fatty acid biosynthetic process	TAS
GO:0043231	Component	Intracellular membrane-bounded organelle	TAS	3460094
GO:0046222	Process	Aflatoxin metabolic process	IEA
GO:0046222	Process	Aflatoxin metabolic process	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0050591	Function	Quinine 3-monooxygenase activity	IEA
GO:0050649	Function	Testosterone 6-beta-hydroxylase activity	IBA
GO:0050649	Function	Testosterone 6-beta-hydroxylase activity	IEA
GO:0050649	Function	Testosterone 6-beta-hydroxylase activity	IMP	3259858
GO:0062181	Function	1-alpha,25-dihydroxyvitamin D3 23-hydroxylase activity	IDA	29461981
GO:0062187	Function	Anandamide 8,9 epoxidase activity	IEA
GO:0062188	Function	Anandamide 11,12 epoxidase activity	IEA
GO:0062189	Function	Anandamide 14,15 epoxidase activity	IEA
GO:0070576	Function	Vitamin D 24-hydroxylase activity	IDA	15546903
GO:0070989	Process	Oxidative demethylation	IBA
GO:0070989	Process	Oxidative demethylation	IDA	15039299, 18619574
GO:0070989	Process	Oxidative demethylation	IEA
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IBA
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IDA	11555828, 14559847
GO:0101020	Function	Estrogen 16-alpha-hydroxylase activity	IEA
GO:0101021	Function	Estrogen 2-hydroxylase activity	IDA	12865317
GO:0101021	Function	Estrogen 2-hydroxylase activity	IEA
GO:0102320	Function	1,8-cineole 2-exo-monooxygenase activity	IEA

Other IDs

• MIM: 124010
• HGNC: 2637
• e!Ensembl: ENSG00000160868

Protein

• UniProt ID: P08684
• Protein name: Cytochrome P450 3A4 (EC 1.14.14.1) (1,4-cineole 2-exo-monooxygenase) (1,8-cineole 2-exo-monooxygenase) (EC 1.14.14.56) (Albendazole monooxygenase (sulfoxide-forming)) (EC 1.14.14.73) (Albendazole sulfoxidase) (CYPIIIA3) (CYPIIIA4) (Cholesterol 25-hydroxyl
• Protein function: A cytochrome P450 monooxygenase involved in the metabolism of sterols, steroid hormones, retinoids and fatty acids (PubMed:10681376, PubMed:11093772, PubMed:11555828, PubMed:12865317, PubMed:14559847, PubMed:15373842, PubMed:15764715, PubMed:199
• PDB: 1TQN, 1W0E, 1W0F, 1W0G, 2J0D, 2V0M, 3NXU, 3TJS, 3UA1, 4D6Z, 4D75, 4D78, 4D7D, 4I3Q, 4I4G, 4I4H, 4K9T, 4K9U, 4K9V, 4K9W, 4K9X, 4NY4, 5A1P, 5A1R, 5G5J, 5TE8, 5VC0, 5VCC, 5VCD, 5VCE, 5VCG, 6BCZ, 6BD5, 6BD6, 6BD7, 6BD8, 6BDH, 6BDI, 6BDK, 6BDM, 6OO9, 6OOA, 6OOB, 7KS8, 7KSA, 7KVH, 7KVI, 7KVJ, 7KVK, 7KVM, 7KVN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	38 → 493	Cytochrome P450	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in prostate and liver. According to some authors, it is not expressed in brain (PubMed:19094056). According to others, weak levels of expression are measured in some brain locations (PubMed:18545703, PubMed:19359404). Also ex
• Sequence:

  MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMF
  DMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
  AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYS
  MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICV
  FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
  IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV
  NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS
  KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLG
  GLLQPEKPVVLKVESRDGTVSGA

• Sequence length: 503

Pathways

KEGG:

Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Bile secretion
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation

Reactome:

Xenobiotics
Aflatoxin activation and detoxification
Biosynthesis of maresin-like SPMs

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Vitamin D-dependent rickets, type 3	Pathogenic	rs1815413655	RCV001261942	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, OVARIAN EPITHELIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYP3A4 PROMOTER POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYP3A4-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
fentanyl response - Dosage	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
tacrolimus response - Metabolism/PK	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TORSADES DE POINTES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	29075133, 31102151		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	28440407		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12439220, 12846892, 15462611, 17339179, 18385010, 25266680, 25305360		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30898762		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17127240		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	22363234		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28381170		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12439220, 15462611, 17339179, 18385010, 25266680		★☆☆☆☆ Found in Text Mining only
Amaurosis congenita of Leber, type 1	Leber congenital amaurosis	BEFREE	14681232		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29940068		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	25881102	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28794002		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23290512		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	23290512	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28794002		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	23519598, 29194698, 31520256		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29098603		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	11204250		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	11549683		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	10933049	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11956645, 12644831, 15496535, 18566991, 19921206		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	17119944		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	LHGDN	17119944		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	17119944		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	8640913		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11774254, 12692107, 12937874, 14970873, 15496535, 15769614, 16103451, 17827444, 19214745, 19242060, 19679043, 21290248, 21402692, 22472546, 23179402, 24887515, 25410489, 27956118, 28418906, 28919040, 29050342, 30218411, 31477036		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	15496535		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14970873, 15657517, 19214745, 19242060, 19746521, 20844025, 21402692, 22984610, 24887515, 25526449, 27956118, 28418906, 32351149, 32456253, 38215156	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	19214745	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	24870798, 27956118	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	20187983, 20715157, 21342487, 9849581	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	19242060	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22447115, 25024626, 25101946, 26377104, 27113703, 30680535, 31322260, 31462277, 32106230, 32955797, 34257549, 34315286, 34337056, 34737790, 35078445, 36091935, 37089050	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	8640913		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11488523, 14515059, 15731117, 24085358		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37920921	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17373732	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12142725		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	21199372	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30663044, 31064695		★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	27311637, 30414935		★☆☆☆☆ Found in Text Mining only
Cartilage-hair hypoplasia	Cartilage-Hair Hypoplasia	BEFREE	26730802		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	21378598, 36855819	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	18566305		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	27133299, 32126981	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	28304081		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12439220, 15462611, 17339179, 18385010, 25266680, 25305360		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	28008998	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	14681232, 21526375, 22982774, 29204052		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	16455805, 28008998	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	23965431, 26773964		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	26800425, 28990182, 31061321		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	16239354, 29905956		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26964624, 27558232, 27820970, 27859472, 28052338		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	12532467, 16239354, 19212316, 24058572		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	27878760		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26412221, 33886687	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12419308, 12470639, 12625868, 27458137		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	17404718		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12237780, 16753005, 21490239		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21342487, 31608899, 33050883	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31740522	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	18957504		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	Pubtator	18957504	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31652395		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	26184414		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21199372, 24214373, 27556885		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21199372, 24214373, 27556885		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	21199372	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21199372, 24214373, 27556885		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	16917230, 28301431, 31393129		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	27013401, 35872023	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33278326	Associate	★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	28060049		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	24035278, 28221736		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	24035278	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29345985		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	23385102		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29925743, 31025537		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20421791, 24739263, 28919040, 28962047, 29546446, 29792708		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18097620, 20421791, 21323901, 24739263, 28042936, 28919040, 28962047, 29546446, 29792708		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21323901, 33053111	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29792708	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29439084, 36767268	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36734157	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17912464, 19596526, 24996290, 28954402, 28962047, 31002385, 31099895, 31269743		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	17912464		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disorders of Porphyrin Metabolism	Porphyria	BEFREE	12463733		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	28335376	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12970323, 17434921		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	17434921		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	27995413		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	21294720	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	24125961, 26421491, 27276192, 31243719		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17373732	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	17368239		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29738703, 29792708		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	24832862		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	27611887		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	38448381	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	31441961		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	16338278		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	16914578		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	28335376	Associate	★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	BEFREE	29679912		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22429982	Associate	★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	19011599		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	31282592		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	BEFREE	11067738		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	38117809	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31652395		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	23965431	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	14512701, 15006542, 9512926		★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	19596526		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	34117631	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29941014		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29941014		★☆☆☆☆ Found in Text Mining only
Hypercalcemia Infantile	Idiopathic infantile hypercalcemia	Pubtator	36990163	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	18097620, 22120734, 23252946		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	35839255	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	28727815	Associate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	28843775		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	18825162, 30910847, 36011305, 36982571	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18097620, 18496130, 19907160, 20617557, 23863802, 24338455, 26810136, 27756246, 28042936, 29194698, 30861159, 30910847, 31441067		★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	19907160		★☆☆☆☆ Found in Text Mining only
Hypertensive Nephropathy	Hypertensive nephropathy	Pubtator	27756246	Associate	★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	32515122	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30320358	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24886881, 26674743		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	9849581	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	31773688	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29500141, 31064695		★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	12532467		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	19907160, 24469018		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	35135554	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	30072148, 30826567		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	23965431, 26773964	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	20402562, 22005822, 31403362, 31579949		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	15700027, 23965431, 26773964		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	21380731		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21595477	Inhibit	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	9789061		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	9789061	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	22785256	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30898762, 35332831	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11051261, 17118447, 17761709, 28161120, 30898762, 30920135, 31670517		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	17992531, 20068078		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	28127194	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10519413, 10748080, 12601364, 15454734, 16708050, 19596526, 20080160, 22363234, 22984610, 24782212, 26377104, 27482056, 29109094, 29145161, 29983591, 30203228, 30234976, 31792727		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15334674		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	12532467, 15364537, 16239354, 19212316, 24058572, 28065770		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	12532467		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	12532467, 24058572	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	12532467, 16455805	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	28008998	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	22291093		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22363234, 22763214, 22984610, 24782212, 26377104, 27482056, 29145161, 31792727		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	14515059		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15731117		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24085358, 32464168	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	17634410		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	15475069		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11774254, 12692107, 12937874, 14970873, 15496535, 15769614, 16103451, 17827444, 19214745, 19242060, 19679043, 19746521, 21290248, 21402692, 22472546, 23179402, 24887515, 25410489, 27956118, 28418906, 28919040, 29050342, 30218411, 31477036		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	15496535		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	12970323, 17434921		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	17605821		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30627802		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11488523, 14515059, 15731117, 24085358, 26964624		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12142725		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30326853		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10548319, 10660343, 11956645, 12107441, 12142725, 12446983, 12644831, 12690615, 14504207, 14515059, 14560315, 15496535, 15540736, 15548719, 16414488, 16430309, 17548691, 17854673, 17914095, 18438175, 19505920, 20027111, 20621111, 20884258, 22050110, 23129512, 23179402, 24924803, 24989928, 25337833, 28340451, 9719084		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15496535		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31441961		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30931962, 31295928		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	8640913		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12630977, 12846892, 15623611, 16243813, 16890579, 17189422, 17992531, 18388870, 19011599, 19376514, 22763214, 23179402, 23327575, 24603336, 24989928, 25542188, 25644970, 26964624, 27458137, 28661568, 28852909, 28919040, 29098381, 29223619, 29502154, 29689707, 29846137, 30367352, 30428505, 30481027, 31074516, 31236938		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12470639, 27458137		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	15496535		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11774254, 14970873, 21750466, 28919040		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12738724, 17434921		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	15496535		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	15496535		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	20617557		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	30320358	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30200275	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29925743, 31025537		★☆☆☆☆ Found in Text Mining only
Mental impairment	Mental Depression	BEFREE	28304081		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	33277605	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17766366, 30663044		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	29851709		★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	21378598	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25915157		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33170343, 36581339	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21346221		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11051261		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16914578, 20054526, 26300393		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	31670517		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25303298		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	16113837		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	21142270, 21545622, 24835295, 24974574, 28065770, 30714173, 31628882		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11774254, 12690615, 16154799, 16281975, 16414488, 16708050, 17548691, 19596526, 28404946, 29109094, 29774122, 31236938, 31670839, 31792727, 9719084		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	30156148		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25370902		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	25398452		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	17992531, 20068078		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	17368239, 27482056, 28303724, 29792708, 30120929, 30248338, 31132328, 31191607		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18258609, 28444958		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22299599, 33277605	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29738703		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	21402692		★☆☆☆☆ Found in Text Mining only
Osteomalacia	Osteomalacia	Pubtator	22562045, 23212742	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	11360662, 19020497		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	LHGDN	19020497		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	22562045	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	17279585		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	CTD_human_DG	17279585		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	30065912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Diseases	Ovarian diseases	Pubtator	19127255	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Dysgenesis 2	Ovarian dysgenesis	Pubtator	19376514	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	12142725		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	19127255		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19127255	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30326853		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33053111	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23565891, 8627546		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	27611887		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	27611887	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	12846892		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	12846892	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	12846892		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	17634410		★☆☆☆☆ Found in Text Mining only
Porphyria Acute Intermittent	Porphyria	Pubtator	30808393	Associate	★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	15896485		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	25305360		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	16584389, 17696930		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10548319, 10660343, 11956645, 12107441, 12446983, 12644831, 12690615, 14504207, 14560315, 15496535, 15540736, 15548719, 16414488, 16430309, 17548691, 17854673, 17914095, 18438175, 19505920, 20027111, 20621111, 20884258, 22050110, 23129512, 23179402, 24924803, 24989928, 25337833, 28340451, 9719084		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	12644831, 19921206	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12107441		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12644831, 21493872, 22050110, 24924803, 25337833, 27164191, 36688864, 38297388	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15496535		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	9719084		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	31228872		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32738269	Associate	★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	31025537		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	26184414, 27761990, 29095797, 29239000, 30121419, 30595680		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	39884806	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27722854		★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	BEFREE	29461981		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	17189422		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	25670065	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19395426, 19591893, 24739668, 27639091		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19591893		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	18797458		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	29679912, 31243719	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	14515059, 16430309		★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	15365655		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17373732		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	31829834		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	19963139		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	17368239, 31191607		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	BEFREE	24861996, 26567871		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31441961		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20187983, 31773688, 38448381, 9569036	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	18566305		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	25881102	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30931962, 31295928		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30931962, 31295928		★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	CTD_human_DG	15875343		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	24861996		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	31650711		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38157645	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21289623		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	29153269, 29461981		★☆☆☆☆ Found in Text Mining only
Xanthomatosis Cerebrotendinous	Xanthomatosis	Pubtator	37679568	Associate	★☆☆☆☆ Found in Text Mining only
Xanthomatosis, Cerebrotendinous	Cholestanol storage disease	BEFREE	11454857		★☆☆☆☆ Found in Text Mining only
Zellweger Syndrome	Zellweger Syndrome	BEFREE	27931149		★☆☆☆☆ Found in Text Mining only