Gene Gene information from NCBI Gene database.
Entrez ID 157506
Gene name Retinol dehydrogenase 10
Gene symbol RDH10
Synonyms (NCBI Gene)
SDR16C4
Chromosome 8
Chromosome location 8q21.11
Summary This gene encodes a retinol dehydrogenase, which converts all-trans-retinol to all-trans-retinal, with preference for NADP as a cofactor. Studies in mice suggest that this protein is essential for synthesis of embryonic retinoic acid and is required for l
miRNA miRNA information provided by mirtarbase database.
524
miRTarBase ID miRNA Experiments Reference
MIRT003051 hsa-miR-124-3p Luciferase reporter assay 17724173
MIRT001600 hsa-let-7b-5p pSILACLuciferase reporter assay 18668040
MIRT003051 hsa-miR-124-3p Microarray 18668037
MIRT003051 hsa-miR-124-3p Reporter assay 17724173
MIRT026079 hsa-miR-196a-5p Sequencing 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
38
GO ID Ontology Definition Evidence Reference
GO:0001523 Process Retinoid metabolic process TAS
GO:0001656 Process Metanephros development IEA
GO:0001701 Process In utero embryonic development IEA
GO:0002138 Process Retinoic acid biosynthetic process IEA
GO:0004745 Function All-trans-retinol dehydrogenase (NAD+) activity IDA 12407145, 19458327
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607599 19975 ENSG00000121039
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IZV5
Protein name Retinol dehydrogenase 10 (EC 1.1.1.300) (Short chain dehydrogenase/reductase family 16C member 4)
Protein function Retinol dehydrogenase with a clear preference for NADP. Converts all-trans-retinol to all-trans-retinal. Has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00106 adh_short 81 259 short chain dehydrogenase Domain
Tissue specificity TISSUE SPECIFICITY: Detected in retina, kidney, liver, small intestine, placenta, lung, heart and skeletal muscle. {ECO:0000269|PubMed:12407145, ECO:0000269|PubMed:14596915}.
Sequence
MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRR
ALLVLWDINTQSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG
KRENVYLTAERVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAF
LPTMLEINHGHIVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTL
VCPYLVDTGMFRGCRIRKE
IEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMK
SILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI
Sequence length 341
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Retinol metabolism
Metabolic pathways
  The canonical retinoid cycle in rods (twilight vision)
RA biosynthesis pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CRANIOFACIAL ABNORMALITIES CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anaplastic carcinoma Anaplastic Carcinoma BEFREE 23639973
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 23639973
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 17218779 Associate
★☆☆☆☆
Found in Text Mining only
Choanal Atresia Choanal Atresia BEFREE 28169399
★☆☆☆☆
Found in Text Mining only
Glioma Glioma BEFREE 29285249, 31613821
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 31613821 Associate
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 17218779
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma LHGDN 17218779
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 29285249
★☆☆☆☆
Found in Text Mining only
Non-Small Cell Lung Carcinoma Lung carcinoma BEFREE 19473719
★☆☆☆☆
Found in Text Mining only