CYP2C18 (cytochrome P450 family 2 subfamily C member 18)

Gene

• Entrez ID: 1562
• Gene name: Cytochrome P450 family 2 subfamily C member 18
• Gene symbol: CYP2C18
• Synonyms (NCBI Gene): CPCI, CYP2C, CYP2C17, P450-6B/29C, P450IIC17
• Chromosome: 10
• Chromosome location: 10q23.33
• Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2208605	hsa-miR-2278	CLIP-seq
MIRT2208606	hsa-miR-23a	CLIP-seq
MIRT2208607	hsa-miR-23b	CLIP-seq
MIRT2208608	hsa-miR-23c	CLIP-seq
MIRT2208609	hsa-miR-2467-3p	CLIP-seq
MIRT2208610	hsa-miR-3123	CLIP-seq
MIRT2208611	hsa-miR-3678-3p	CLIP-seq
MIRT2208612	hsa-miR-3919	CLIP-seq
MIRT2208613	hsa-miR-412	CLIP-seq
MIRT2208614	hsa-miR-4640-5p	CLIP-seq
MIRT2208615	hsa-miR-4726-5p	CLIP-seq
MIRT2208616	hsa-miR-518d-5p	CLIP-seq
MIRT2208617	hsa-miR-519b-5p	CLIP-seq
MIRT2208618	hsa-miR-519c-5p	CLIP-seq
MIRT2208619	hsa-miR-520c-5p	CLIP-seq
MIRT2208620	hsa-miR-526a	CLIP-seq
MIRT2428045	hsa-miR-1206	CLIP-seq
MIRT2428046	hsa-miR-3126-5p	CLIP-seq
MIRT2428047	hsa-miR-4419a	CLIP-seq
MIRT2428048	hsa-miR-4510	CLIP-seq
MIRT2428049	hsa-miR-4764-5p	CLIP-seq
MIRT2428050	hsa-miR-526b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	TAS	8110777
GO:0005506	Function	Iron ion binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006721	Process	Terpenoid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008392	Function	Arachidonate epoxygenase activity	IEA
GO:0008401	Function	Retinoic acid 4-hydroxylase activity	IDA	11093772
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019373	Process	Epoxygenase P450 pathway	IBA
GO:0019825	Function	Oxygen binding	TAS	8110777
GO:0020037	Function	Heme binding	IBA
GO:0020037	Function	Heme binding	IEA
GO:0032787	Process	Monocarboxylic acid metabolic process	IEA
GO:0042178	Process	Xenobiotic catabolic process	IBA
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042573	Process	Retinoic acid metabolic process	IDA	11093772
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0043651	Process	Linoleic acid metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071614	Function	Linoleic acid epoxygenase activity	IEA

Other IDs

• MIM: 601131
• HGNC: 2620
• e!Ensembl: ENSG00000108242

Protein

• UniProt ID: P33260
• Protein name: Cytochrome P450 2C18 (EC 1.14.14.1) (CYPIIC18) (Cytochrome P450-6b/29c)
• Protein function: A cytochrome P450 monooxygenase involved in retinoid metabolism. Hydroxylates all trans-retinoic acid (atRA) to 4-hydroxyretinoate and may modulate atRA signaling and clearance. Mechanistically, uses molecular oxygen inserting one oxygen atom in
• PDB: 2CIK, 2H6P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	30 → 487	Cytochrome P450	Domain

• Sequence:

  MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKV
  YGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRW
  KEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICS
  VIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYI
  KSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTE
  TTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYID
  LLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFK
  KSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVP
  PLYQLCFIPV

• Sequence length: 490

Pathways

KEGG:

Retinol metabolism
Metabolic pathways
Serotonergic synapse
Chemical carcinogenesis - DNA adducts

Reactome:

Xenobiotics

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GLIOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	14759713		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11488523		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28099906	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29023376		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29718219		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21476972		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21476972		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28687336		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	35794104	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21939641, 28954402, 29023376		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	27417579		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	8593788		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	19415824, 8874828, 9333104		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	28513222		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	17627038		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	23801863	Associate	★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	CTD_human_DG	9766669		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	17597703, 25986599, 28513222, 28899749		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	23801863	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16077914, 29479826		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14759713		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11488523		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	21716162		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	9766669		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	14759713		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	21939641, 29865786		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28099906	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	20808793		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	23267857		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	21716162		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal Diseases	Retinal Diseases	BEFREE	24458713, 27417579		★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	29274302		★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	29274302		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29130833		★☆☆☆☆ Found in Text Mining only
Xerocytosis	Xerocytosis	BEFREE	28391407		★☆☆☆☆ Found in Text Mining only