CYP2B6 (cytochrome P450 family 2 subfamily B member 6)

Gene

• Entrez ID: 1555
• Gene name: Cytochrome P450 family 2 subfamily B member 6
• Gene symbol: CYP2B6
• Synonyms (NCBI Gene): CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6, EFVM, IIB1, P450
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This prot

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs2279343	A>G	Drug-response, benign	Coding sequence variant, missense variant
rs2279345	T>A,C,G	Drug-response	Intron variant
rs3745274	G>A,T	Drug-response	Synonymous variant, coding sequence variant, missense variant
rs4803419	C>T	Drug-response	Intron variant
rs28399499	T>C	Drug-response	Coding sequence variant, missense variant
rs34097093	C>T	Drug-response	Stop gained, coding sequence variant
rs36079186	T>C	Drug-response	Coding sequence variant, missense variant
rs139801276	T>C	Drug-response	Missense variant, coding sequence variant
rs186335453	G>C,T	Drug-response	Missense variant, coding sequence variant
rs281864907	T>A	Drug-response	Coding sequence variant, stop gained
rs371424910	T>C	Drug-response	Missense variant, coding sequence variant
rs373489637	T>G	Drug-response	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051706	hsa-let-7e-5p	CLASH	23622248
MIRT647556	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT647555	hsa-miR-1470	HITS-CLIP	23824327
MIRT647554	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT647553	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT647552	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT647551	hsa-miR-4287	HITS-CLIP	23824327
MIRT647550	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT647549	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT647548	hsa-miR-20a-3p	HITS-CLIP	23824327
MIRT647547	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT647546	hsa-miR-498	HITS-CLIP	23824327
MIRT626340	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT626339	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT626338	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT626336	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT626335	hsa-miR-5193	HITS-CLIP	23824327
MIRT626334	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT626333	hsa-miR-587	HITS-CLIP	23824327
MIRT626340	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT626339	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT626338	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT626337	hsa-miR-1247-5p	HITS-CLIP	23824327
MIRT626336	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT626335	hsa-miR-5193	HITS-CLIP	23824327
MIRT626334	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT626333	hsa-miR-587	HITS-CLIP	23824327
MIRT458552	hsa-miR-4707-5p	PAR-CLIP	23592263
MIRT458551	hsa-miR-5587-3p	PAR-CLIP	23592263
MIRT458550	hsa-miR-4532	PAR-CLIP	23592263
MIRT458549	hsa-miR-4787-5p	PAR-CLIP	23592263
MIRT458548	hsa-miR-4537	PAR-CLIP	23592263
MIRT458547	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT458546	hsa-miR-6086	PAR-CLIP	23592263
MIRT458545	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT458544	hsa-miR-3689d	PAR-CLIP	23592263
MIRT458543	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT458542	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT458541	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT458540	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT458539	hsa-miR-4651	PAR-CLIP	23592263
MIRT458538	hsa-miR-608	PAR-CLIP	23592263
MIRT458537	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT458536	hsa-miR-6745	PAR-CLIP	23592263
MIRT458535	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT458534	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT458533	hsa-miR-6763-3p	PAR-CLIP	23592263
MIRT458532	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT458531	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT734347	hsa-miR-605-3p	Luciferase reporter assay, qRT-PCR, Western blotting	31766967
MIRT736659	hsa-miR-4254	RNA-seq	32772362
MIRT736660	hsa-miR-6867-5p	RNA-seq	32772362
MIRT647556	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT647555	hsa-miR-1470	HITS-CLIP	23824327
MIRT647554	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT647553	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT647552	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT647551	hsa-miR-4287	HITS-CLIP	23824327
MIRT647550	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT647549	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT647548	hsa-miR-20a-3p	HITS-CLIP	23824327
MIRT647547	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT647546	hsa-miR-498	HITS-CLIP	23824327
MIRT626340	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT626339	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT626338	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT626336	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT626335	hsa-miR-5193	HITS-CLIP	23824327
MIRT626334	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT626333	hsa-miR-587	HITS-CLIP	23824327
MIRT626340	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT626339	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT626338	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT626337	hsa-miR-1247-5p	HITS-CLIP	23824327
MIRT626336	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT626335	hsa-miR-5193	HITS-CLIP	23824327
MIRT626334	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT626333	hsa-miR-587	HITS-CLIP	23824327
MIRT458552	hsa-miR-4707-5p	PAR-CLIP	23592263
MIRT458551	hsa-miR-5587-3p	PAR-CLIP	23592263
MIRT458550	hsa-miR-4532	PAR-CLIP	23592263
MIRT458549	hsa-miR-4787-5p	PAR-CLIP	23592263
MIRT458548	hsa-miR-4537	PAR-CLIP	23592263
MIRT458547	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT458546	hsa-miR-6086	PAR-CLIP	23592263
MIRT458545	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT458544	hsa-miR-3689d	PAR-CLIP	23592263
MIRT458543	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT458542	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT458541	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT458540	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT458539	hsa-miR-4651	PAR-CLIP	23592263
MIRT458538	hsa-miR-608	PAR-CLIP	23592263
MIRT458537	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT458536	hsa-miR-6745	PAR-CLIP	23592263
MIRT458535	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT458534	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT458533	hsa-miR-6763-3p	PAR-CLIP	23592263
MIRT458532	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT458531	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT921288	hsa-miR-1262	CLIP-seq
MIRT921289	hsa-miR-1265	CLIP-seq
MIRT921290	hsa-miR-1273e	CLIP-seq
MIRT921291	hsa-miR-130a	CLIP-seq
MIRT921292	hsa-miR-130b	CLIP-seq
MIRT921293	hsa-miR-1321	CLIP-seq
MIRT921294	hsa-miR-1827	CLIP-seq
MIRT921295	hsa-miR-18a	CLIP-seq
MIRT921296	hsa-miR-18b	CLIP-seq
MIRT921297	hsa-miR-297	CLIP-seq
MIRT921298	hsa-miR-301a	CLIP-seq
MIRT921299	hsa-miR-301b	CLIP-seq
MIRT921300	hsa-miR-3115	CLIP-seq
MIRT921301	hsa-miR-3122	CLIP-seq
MIRT921302	hsa-miR-3138	CLIP-seq
MIRT921303	hsa-miR-3149	CLIP-seq
MIRT921304	hsa-miR-3153	CLIP-seq
MIRT921305	hsa-miR-3162-5p	CLIP-seq
MIRT921306	hsa-miR-34b	CLIP-seq
MIRT921307	hsa-miR-3613-3p	CLIP-seq
MIRT921308	hsa-miR-3614-5p	CLIP-seq
MIRT921309	hsa-miR-3666	CLIP-seq
MIRT921310	hsa-miR-3671	CLIP-seq
MIRT921311	hsa-miR-3689a-3p	CLIP-seq
MIRT921312	hsa-miR-3689c	CLIP-seq
MIRT921313	hsa-miR-371-5p	CLIP-seq
MIRT921314	hsa-miR-371b-5p	CLIP-seq
MIRT921315	hsa-miR-374a	CLIP-seq
MIRT921316	hsa-miR-374b	CLIP-seq
MIRT921317	hsa-miR-3913-5p	CLIP-seq
MIRT921318	hsa-miR-3929	CLIP-seq
MIRT921319	hsa-miR-3975	CLIP-seq
MIRT921320	hsa-miR-4295	CLIP-seq
MIRT921321	hsa-miR-4419b	CLIP-seq
MIRT921322	hsa-miR-4433	CLIP-seq
MIRT921323	hsa-miR-4459	CLIP-seq
MIRT921324	hsa-miR-4478	CLIP-seq
MIRT921325	hsa-miR-4491	CLIP-seq
MIRT921326	hsa-miR-4504	CLIP-seq
MIRT921327	hsa-miR-4520a-3p	CLIP-seq
MIRT921328	hsa-miR-454	CLIP-seq
MIRT921329	hsa-miR-4649-3p	CLIP-seq
MIRT921330	hsa-miR-4652-3p	CLIP-seq
MIRT921331	hsa-miR-4657	CLIP-seq
MIRT921332	hsa-miR-4668-5p	CLIP-seq
MIRT921333	hsa-miR-4671-3p	CLIP-seq
MIRT921334	hsa-miR-4701-3p	CLIP-seq
MIRT921335	hsa-miR-4722-5p	CLIP-seq
MIRT921336	hsa-miR-4728-5p	CLIP-seq
MIRT921337	hsa-miR-4735-3p	CLIP-seq
MIRT921338	hsa-miR-4739	CLIP-seq
MIRT921339	hsa-miR-4756-5p	CLIP-seq
MIRT921340	hsa-miR-4764-5p	CLIP-seq
MIRT921341	hsa-miR-4768-3p	CLIP-seq
MIRT921342	hsa-miR-4775	CLIP-seq
MIRT921343	hsa-miR-4778-5p	CLIP-seq
MIRT921344	hsa-miR-485-5p	CLIP-seq
MIRT921345	hsa-miR-548c-3p	CLIP-seq
MIRT921346	hsa-miR-568	CLIP-seq
MIRT921347	hsa-miR-590-3p	CLIP-seq
MIRT921348	hsa-miR-640	CLIP-seq
MIRT921349	hsa-miR-656	CLIP-seq
MIRT921350	hsa-miR-940	CLIP-seq
MIRT1972981	hsa-miR-1285	CLIP-seq
MIRT1972982	hsa-miR-1293	CLIP-seq
MIRT921295	hsa-miR-18a	CLIP-seq
MIRT921296	hsa-miR-18b	CLIP-seq
MIRT921301	hsa-miR-3122	CLIP-seq
MIRT1972983	hsa-miR-3187-5p	CLIP-seq
MIRT1972984	hsa-miR-3652	CLIP-seq
MIRT921311	hsa-miR-3689a-3p	CLIP-seq
MIRT921312	hsa-miR-3689c	CLIP-seq
MIRT921317	hsa-miR-3913-5p	CLIP-seq
MIRT921319	hsa-miR-3975	CLIP-seq
MIRT1972985	hsa-miR-4430	CLIP-seq
MIRT1972986	hsa-miR-4483	CLIP-seq
MIRT1972987	hsa-miR-4505	CLIP-seq
MIRT921329	hsa-miR-4649-3p	CLIP-seq
MIRT921336	hsa-miR-4728-5p	CLIP-seq
MIRT921337	hsa-miR-4735-3p	CLIP-seq
MIRT1972988	hsa-miR-4793-3p	CLIP-seq
MIRT1972989	hsa-miR-4802-3p	CLIP-seq
MIRT1972990	hsa-miR-564	CLIP-seq
MIRT1972991	hsa-miR-612	CLIP-seq
MIRT921349	hsa-miR-656	CLIP-seq
MIRT921288	hsa-miR-1262	CLIP-seq
MIRT921289	hsa-miR-1265	CLIP-seq
MIRT2208593	hsa-miR-128	CLIP-seq
MIRT1972981	hsa-miR-1285	CLIP-seq
MIRT921291	hsa-miR-130a	CLIP-seq
MIRT921292	hsa-miR-130b	CLIP-seq
MIRT921293	hsa-miR-1321	CLIP-seq
MIRT921295	hsa-miR-18a	CLIP-seq
MIRT921296	hsa-miR-18b	CLIP-seq
MIRT921298	hsa-miR-301a	CLIP-seq
MIRT921299	hsa-miR-301b	CLIP-seq
MIRT921301	hsa-miR-3122	CLIP-seq
MIRT921302	hsa-miR-3138	CLIP-seq
MIRT921305	hsa-miR-3162-5p	CLIP-seq
MIRT2208594	hsa-miR-3176	CLIP-seq
MIRT1972983	hsa-miR-3187-5p	CLIP-seq
MIRT921306	hsa-miR-34b	CLIP-seq
MIRT921308	hsa-miR-3614-5p	CLIP-seq
MIRT921309	hsa-miR-3666	CLIP-seq
MIRT921311	hsa-miR-3689a-3p	CLIP-seq
MIRT921312	hsa-miR-3689c	CLIP-seq
MIRT921317	hsa-miR-3913-5p	CLIP-seq
MIRT2208595	hsa-miR-3922-3p	CLIP-seq
MIRT921318	hsa-miR-3929	CLIP-seq
MIRT921319	hsa-miR-3975	CLIP-seq
MIRT2208596	hsa-miR-4252	CLIP-seq
MIRT921320	hsa-miR-4295	CLIP-seq
MIRT2208597	hsa-miR-4302	CLIP-seq
MIRT921321	hsa-miR-4419b	CLIP-seq
MIRT921322	hsa-miR-4433	CLIP-seq
MIRT921323	hsa-miR-4459	CLIP-seq
MIRT921324	hsa-miR-4478	CLIP-seq
MIRT921325	hsa-miR-4491	CLIP-seq
MIRT2208598	hsa-miR-4501	CLIP-seq
MIRT921327	hsa-miR-4520a-3p	CLIP-seq
MIRT921328	hsa-miR-454	CLIP-seq
MIRT921331	hsa-miR-4657	CLIP-seq
MIRT921333	hsa-miR-4671-3p	CLIP-seq
MIRT2208599	hsa-miR-4672	CLIP-seq
MIRT921334	hsa-miR-4701-3p	CLIP-seq
MIRT2208600	hsa-miR-4709-5p	CLIP-seq
MIRT921336	hsa-miR-4728-5p	CLIP-seq
MIRT921337	hsa-miR-4735-3p	CLIP-seq
MIRT921338	hsa-miR-4739	CLIP-seq
MIRT921339	hsa-miR-4756-5p	CLIP-seq
MIRT921340	hsa-miR-4764-5p	CLIP-seq
MIRT921341	hsa-miR-4768-3p	CLIP-seq
MIRT1972988	hsa-miR-4793-3p	CLIP-seq
MIRT2208601	hsa-miR-4798-3p	CLIP-seq
MIRT921344	hsa-miR-485-5p	CLIP-seq
MIRT2208602	hsa-miR-508-5p	CLIP-seq
MIRT1972990	hsa-miR-564	CLIP-seq
MIRT921347	hsa-miR-590-3p	CLIP-seq
MIRT1972991	hsa-miR-612	CLIP-seq
MIRT921349	hsa-miR-656	CLIP-seq
MIRT2208603	hsa-miR-661	CLIP-seq
MIRT2208604	hsa-miR-766	CLIP-seq
MIRT1972981	hsa-miR-1285	CLIP-seq
MIRT1972983	hsa-miR-3187-5p	CLIP-seq
MIRT921306	hsa-miR-34b	CLIP-seq
MIRT921308	hsa-miR-3614-5p	CLIP-seq
MIRT2386661	hsa-miR-3672	CLIP-seq
MIRT2208596	hsa-miR-4252	CLIP-seq
MIRT2208597	hsa-miR-4302	CLIP-seq
MIRT921322	hsa-miR-4433	CLIP-seq
MIRT921323	hsa-miR-4459	CLIP-seq
MIRT2208600	hsa-miR-4709-5p	CLIP-seq
MIRT921341	hsa-miR-4768-3p	CLIP-seq
MIRT1972988	hsa-miR-4793-3p	CLIP-seq
MIRT2208602	hsa-miR-508-5p	CLIP-seq
MIRT1972991	hsa-miR-612	CLIP-seq
MIRT2208603	hsa-miR-661	CLIP-seq
MIRT2208604	hsa-miR-766	CLIP-seq
MIRT921288	hsa-miR-1262	CLIP-seq
MIRT921291	hsa-miR-130a	CLIP-seq
MIRT921292	hsa-miR-130b	CLIP-seq
MIRT921293	hsa-miR-1321	CLIP-seq
MIRT921294	hsa-miR-1827	CLIP-seq
MIRT921295	hsa-miR-18a	CLIP-seq
MIRT921296	hsa-miR-18b	CLIP-seq
MIRT921298	hsa-miR-301a	CLIP-seq
MIRT921299	hsa-miR-301b	CLIP-seq
MIRT921301	hsa-miR-3122	CLIP-seq
MIRT921305	hsa-miR-3162-5p	CLIP-seq
MIRT921309	hsa-miR-3666	CLIP-seq
MIRT2447916	hsa-miR-3675-3p	CLIP-seq
MIRT921311	hsa-miR-3689a-3p	CLIP-seq
MIRT921312	hsa-miR-3689c	CLIP-seq
MIRT921317	hsa-miR-3913-5p	CLIP-seq
MIRT921318	hsa-miR-3929	CLIP-seq
MIRT921319	hsa-miR-3975	CLIP-seq
MIRT921320	hsa-miR-4295	CLIP-seq
MIRT921321	hsa-miR-4419b	CLIP-seq
MIRT921324	hsa-miR-4478	CLIP-seq
MIRT921328	hsa-miR-454	CLIP-seq
MIRT921329	hsa-miR-4649-3p	CLIP-seq
MIRT2447917	hsa-miR-4662a-5p	CLIP-seq
MIRT921333	hsa-miR-4671-3p	CLIP-seq
MIRT2447918	hsa-miR-4684-5p	CLIP-seq
MIRT921334	hsa-miR-4701-3p	CLIP-seq
MIRT921336	hsa-miR-4728-5p	CLIP-seq
MIRT921337	hsa-miR-4735-3p	CLIP-seq
MIRT921338	hsa-miR-4739	CLIP-seq
MIRT921339	hsa-miR-4756-5p	CLIP-seq
MIRT921344	hsa-miR-485-5p	CLIP-seq
MIRT921345	hsa-miR-548c-3p	CLIP-seq
MIRT921350	hsa-miR-940	CLIP-seq
MIRT921291	hsa-miR-130a	CLIP-seq
MIRT921292	hsa-miR-130b	CLIP-seq
MIRT921293	hsa-miR-1321	CLIP-seq
MIRT921294	hsa-miR-1827	CLIP-seq
MIRT921295	hsa-miR-18a	CLIP-seq
MIRT921296	hsa-miR-18b	CLIP-seq
MIRT921298	hsa-miR-301a	CLIP-seq
MIRT921299	hsa-miR-301b	CLIP-seq
MIRT921301	hsa-miR-3122	CLIP-seq
MIRT921305	hsa-miR-3162-5p	CLIP-seq
MIRT921309	hsa-miR-3666	CLIP-seq
MIRT921311	hsa-miR-3689a-3p	CLIP-seq
MIRT921312	hsa-miR-3689c	CLIP-seq
MIRT921317	hsa-miR-3913-5p	CLIP-seq
MIRT921318	hsa-miR-3929	CLIP-seq
MIRT921319	hsa-miR-3975	CLIP-seq
MIRT921320	hsa-miR-4295	CLIP-seq
MIRT921321	hsa-miR-4419b	CLIP-seq
MIRT921324	hsa-miR-4478	CLIP-seq
MIRT921328	hsa-miR-454	CLIP-seq
MIRT921329	hsa-miR-4649-3p	CLIP-seq
MIRT921333	hsa-miR-4671-3p	CLIP-seq
MIRT921335	hsa-miR-4722-5p	CLIP-seq
MIRT921336	hsa-miR-4728-5p	CLIP-seq
MIRT921337	hsa-miR-4735-3p	CLIP-seq
MIRT921338	hsa-miR-4739	CLIP-seq
MIRT921339	hsa-miR-4756-5p	CLIP-seq
MIRT921341	hsa-miR-4768-3p	CLIP-seq
MIRT921344	hsa-miR-485-5p	CLIP-seq
MIRT921350	hsa-miR-940	CLIP-seq
MIRT921288	hsa-miR-1262	CLIP-seq
MIRT2208593	hsa-miR-128	CLIP-seq
MIRT921291	hsa-miR-130a	CLIP-seq
MIRT921292	hsa-miR-130b	CLIP-seq
MIRT921293	hsa-miR-1321	CLIP-seq
MIRT921294	hsa-miR-1827	CLIP-seq
MIRT921295	hsa-miR-18a	CLIP-seq
MIRT921296	hsa-miR-18b	CLIP-seq
MIRT921298	hsa-miR-301a	CLIP-seq
MIRT921299	hsa-miR-301b	CLIP-seq
MIRT2512468	hsa-miR-3120-5p	CLIP-seq
MIRT921301	hsa-miR-3122	CLIP-seq
MIRT921305	hsa-miR-3162-5p	CLIP-seq
MIRT921307	hsa-miR-3613-3p	CLIP-seq
MIRT2512469	hsa-miR-3664-5p	CLIP-seq
MIRT921309	hsa-miR-3666	CLIP-seq
MIRT2386661	hsa-miR-3672	CLIP-seq
MIRT2447916	hsa-miR-3675-3p	CLIP-seq
MIRT921311	hsa-miR-3689a-3p	CLIP-seq
MIRT921312	hsa-miR-3689c	CLIP-seq
MIRT921313	hsa-miR-371-5p	CLIP-seq
MIRT921314	hsa-miR-371b-5p	CLIP-seq
MIRT921317	hsa-miR-3913-5p	CLIP-seq
MIRT921318	hsa-miR-3929	CLIP-seq
MIRT921319	hsa-miR-3975	CLIP-seq
MIRT921320	hsa-miR-4295	CLIP-seq
MIRT2512470	hsa-miR-4330	CLIP-seq
MIRT921321	hsa-miR-4419b	CLIP-seq
MIRT921324	hsa-miR-4478	CLIP-seq
MIRT2512471	hsa-miR-4522	CLIP-seq
MIRT2512472	hsa-miR-4536	CLIP-seq
MIRT921328	hsa-miR-454	CLIP-seq
MIRT921329	hsa-miR-4649-3p	CLIP-seq
MIRT2447917	hsa-miR-4662a-5p	CLIP-seq
MIRT921333	hsa-miR-4671-3p	CLIP-seq
MIRT2208599	hsa-miR-4672	CLIP-seq
MIRT2447918	hsa-miR-4684-5p	CLIP-seq
MIRT921334	hsa-miR-4701-3p	CLIP-seq
MIRT921335	hsa-miR-4722-5p	CLIP-seq
MIRT921336	hsa-miR-4728-5p	CLIP-seq
MIRT921337	hsa-miR-4735-3p	CLIP-seq
MIRT921338	hsa-miR-4739	CLIP-seq
MIRT921339	hsa-miR-4756-5p	CLIP-seq
MIRT921341	hsa-miR-4768-3p	CLIP-seq
MIRT2512473	hsa-miR-4797-5p	CLIP-seq
MIRT921344	hsa-miR-485-5p	CLIP-seq
MIRT921345	hsa-miR-548c-3p	CLIP-seq
MIRT2512474	hsa-miR-759	CLIP-seq
MIRT921350	hsa-miR-940	CLIP-seq
MIRT921288	hsa-miR-1262	CLIP-seq
MIRT2208593	hsa-miR-128	CLIP-seq
MIRT921291	hsa-miR-130a	CLIP-seq
MIRT921292	hsa-miR-130b	CLIP-seq
MIRT921293	hsa-miR-1321	CLIP-seq
MIRT921294	hsa-miR-1827	CLIP-seq
MIRT921295	hsa-miR-18a	CLIP-seq
MIRT921296	hsa-miR-18b	CLIP-seq
MIRT921298	hsa-miR-301a	CLIP-seq
MIRT921299	hsa-miR-301b	CLIP-seq
MIRT921301	hsa-miR-3122	CLIP-seq
MIRT921305	hsa-miR-3162-5p	CLIP-seq
MIRT921309	hsa-miR-3666	CLIP-seq
MIRT2386661	hsa-miR-3672	CLIP-seq
MIRT2447916	hsa-miR-3675-3p	CLIP-seq
MIRT921311	hsa-miR-3689a-3p	CLIP-seq
MIRT921312	hsa-miR-3689c	CLIP-seq
MIRT921317	hsa-miR-3913-5p	CLIP-seq
MIRT921318	hsa-miR-3929	CLIP-seq
MIRT921319	hsa-miR-3975	CLIP-seq
MIRT921320	hsa-miR-4295	CLIP-seq
MIRT2512470	hsa-miR-4330	CLIP-seq
MIRT921321	hsa-miR-4419b	CLIP-seq
MIRT921324	hsa-miR-4478	CLIP-seq
MIRT2512472	hsa-miR-4536	CLIP-seq
MIRT921328	hsa-miR-454	CLIP-seq
MIRT921329	hsa-miR-4649-3p	CLIP-seq
MIRT2447917	hsa-miR-4662a-5p	CLIP-seq
MIRT921333	hsa-miR-4671-3p	CLIP-seq
MIRT2208599	hsa-miR-4672	CLIP-seq
MIRT2447918	hsa-miR-4684-5p	CLIP-seq
MIRT921334	hsa-miR-4701-3p	CLIP-seq
MIRT921335	hsa-miR-4722-5p	CLIP-seq
MIRT921336	hsa-miR-4728-5p	CLIP-seq
MIRT921337	hsa-miR-4735-3p	CLIP-seq
MIRT921338	hsa-miR-4739	CLIP-seq
MIRT921339	hsa-miR-4756-5p	CLIP-seq
MIRT921341	hsa-miR-4768-3p	CLIP-seq
MIRT921344	hsa-miR-485-5p	CLIP-seq
MIRT921345	hsa-miR-548c-3p	CLIP-seq
MIRT921350	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AHR	Unknown	19928584
ATF5	Activation	18332083
EGR1	Activation	18303024
HNF4A	Unknown	18666237
NR1I2	Unknown	18096673;19928584
NR1I3	Activation	19702527
NR1I3	Unknown	19928584
NR5A1	Unknown	7789992

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IDA	19651758
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	TAS
GO:0005506	Function	Iron ion binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IBA
GO:0006805	Process	Xenobiotic metabolic process	IDA	19651758, 20061448
GO:0006805	Process	Xenobiotic metabolic process	IMP	18356043
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008202	Process	Steroid metabolic process	IMP	18356043
GO:0008390	Function	Testosterone 16-alpha-hydroxylase activity	IDA	21289075
GO:0008390	Function	Testosterone 16-alpha-hydroxylase activity	IEA
GO:0008392	Function	Arachidonate epoxygenase activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0019373	Process	Epoxygenase P450 pathway	IBA
GO:0020037	Function	Heme binding	IBA
GO:0020037	Function	Heme binding	IDA	20061448
GO:0020037	Function	Heme binding	IEA
GO:0042178	Process	Xenobiotic catabolic process	IDA	19029318
GO:0042180	Process	Ketone metabolic process	IDA	19651758
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0062184	Function	Testosterone 16-beta-hydroxylase activity	IDA	21289075
GO:0062184	Function	Testosterone 16-beta-hydroxylase activity	IEA
GO:0062187	Function	Anandamide 8,9 epoxidase activity	IDA	21289075
GO:0062187	Function	Anandamide 8,9 epoxidase activity	IEA
GO:0062188	Function	Anandamide 11,12 epoxidase activity	IDA	21289075
GO:0062188	Function	Anandamide 11,12 epoxidase activity	IEA
GO:0062189	Function	Anandamide 14,15 epoxidase activity	IDA	21289075
GO:0062189	Function	Anandamide 14,15 epoxidase activity	IEA
GO:0101021	Function	Estrogen 2-hydroxylase activity	IDA	12865317
GO:0101021	Function	Estrogen 2-hydroxylase activity	IEA

Other IDs

• MIM: 123930
• HGNC: 2615
• e!Ensembl: ENSG00000197408

Protein

• UniProt ID: P20813
• Protein name: Cytochrome P450 2B6 (EC 1.14.13.-) (1,4-cineole 2-exo-monooxygenase) (CYPIIB6) (Cytochrome P450 IIB1)
• Protein function: A cytochrome P450 monooxygenase involved in the metabolism of endocannabinoids and steroids (PubMed:12865317, PubMed:21289075). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a wat
• PDB: 3IBD, 3QOA, 3QU8, 3UA5, 4I91, 4RQL, 4RRT, 4ZV8, 5UAP, 5UDA, 5UEC, 5UFG, 5WBG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	31 → 488	Cytochrome P450	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in liver, lung and heart right ventricle. {ECO:0000269|PubMed:10768437}.
• Sequence:

  MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFRE
  KYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNR
  WKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIIC
  SIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVYKNLQE
  INAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGT
  ETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFS
  DLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGAL
  KKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKI
  PPTYQIRFLPR

• Sequence length: 491

Pathways

KEGG:

Arachidonic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis - receptor activation
Lipid and atherosclerosis

Reactome:

Fatty acids
Xenobiotics
CYP2E1 reactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MASTOCYTOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYP2B6-related disorder	Benign; drug response; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Efavirenz response	Benign; drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
efavirenz response - Metabolism/PK	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
efavirenz response - Toxicity	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MASTOCYTOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nevirapine response - Metabolism/PK	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nevirapine response - Toxicity	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBERCULOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
11-Beta-hydroxylase deficiency	11-beta-hydroxylase deficiency	BEFREE	29543924		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	24368200		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	18394438, 26147597		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	19144407, 20878158, 28440407		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12846892, 18414197, 20878158		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	8555497		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12396873, 14633739		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	11158024		★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	16705068, 22968487		★☆☆☆☆ Found in Text Mining only
Adrenal hyperplasia, congenital, type 5	Adrenal Hyperplasia, Congenital	BEFREE	3274893		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	11139773, 28073588		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	28073588	Associate	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	26937962		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18414197, 20878158		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	9589695		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	30320358		★☆☆☆☆ Found in Text Mining only
Adult Type Ovarian Granulosa Cell Tumor	Ovarian Tumor	BEFREE	8106605, 8263150		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	16705068		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27056331	Associate	★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	BEFREE	23878291		★☆☆☆☆ Found in Text Mining only
AMYOTROPHY, HEREDITARY NEURALGIC	Hereditary Neuralgic Amyotrophy	BEFREE	31836555		★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	23422825		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	25824304, 28232135		★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome with Disordered Steroidogenesis	Antley-Bixler Syndrome	BEFREE	19621255		★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome, Autosomal Dominant	Antley-Bixler Syndrome	BEFREE	14758361, 16915000, 18455494, 18493134, 20124576, 21705796		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	24347450		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	24347450		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	10050706		★☆☆☆☆ Found in Text Mining only
Aromatase deficiency	Aromatase Deficiency	BEFREE	29324451		★☆☆☆☆ Found in Text Mining only
AROMATASE EXCESS SYNDROME	Aromatase Excess Syndrome	BEFREE	9543166		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17701478, 18633604, 28650933		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16855167		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	15124938		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17475630, 21613960		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17701478, 18633604, 28650933		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29098603		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	1723273, 8390333		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21543025, 7704004		★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	15708542		★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	16582078		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	17269966		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	22731640		★☆☆☆☆ Found in Text Mining only
BIETTI CRYSTALLINE CORNEORETINAL DYSTROPHY	Bietti Crystalline Dystrophy	BEFREE	16179904, 16186368		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11350900, 18304215, 20675267, 8752158		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10657957, 10731105, 11280806, 12396873, 14555709, 14639129, 14970873, 15784178, 17440066, 18214058, 18618215, 20179710, 21402692, 22631658, 22702493, 22716309, 22938436, 23824676, 24682508, 25428516, 25526449, 25554091, 26134484, 26652254, 28176668, 28178648, 28985473, 30461653, 31686598, 9500998, 9511180		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15084249, 20079471, 20179710, 23824676, 25526449, 26602960, 27858847, 28178648	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	15928955		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	28081574		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	26235034		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23591849	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	16582078	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19041150, 25024626, 31570105	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	10559661, 9282984		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18304215, 20675267, 8752158		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	9065651		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10454258, 10639518, 10872632, 12396873, 1362539, 15746946, 1820735, 20044584, 20515955, 23591849, 27750412, 28092945, 8299311, 9307183, 9439147, 9610791, 9894148		★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	16582078, 8616834, 9077484, 9950241		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25516145		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17979511		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	21505298, 29847509	Associate	★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	27311637		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	20639527, 28145050, 28492729, 29855606, 31006110, 35512066	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	18414197, 20878158		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	9589695		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	30320358		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	1309352		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	15248218, 15700027		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	15700027, 30074626		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24128861		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19507017, 29767774		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	24058572, 7741759		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	1869518	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	24517233		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33686088, 37322958	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12237780, 12636175, 15897573, 17627011, 23674869, 28045128, 29075787		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	10189236, 16906539, 17223983, 18445671, 20639616, 20844025, 21190981, 22162478, 22262854, 23295302, 2475127, 26172259, 27032764, 28450305, 28539365, 31611378, 31708872, 3490178		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 11-Beta-hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	29543924		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	15483094, 18397975, 18957504		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	Pubtator	1869518	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	20878158, 24586425, 27865701		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	18288954		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	15466638, 16839864, 26941570, 27275533		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	15466638, 16839864, 20093049, 26941570, 27275533		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15466638, 16839864, 26941570, 28687336		★☆☆☆☆ Found in Text Mining only
Corticosterone Methyl Oxidase Type I Deficiency	Corticosterone Methyl Oxidase Deficiency	BEFREE	14614232		★☆☆☆☆ Found in Text Mining only
Corticosterone Methyl Oxidase Type II Deficiency	Corticosterone Methyl Oxidase Deficiency	BEFREE	14614232		★☆☆☆☆ Found in Text Mining only
Cortisone reductase deficiency	Cortisone Reductase Deficiency	BEFREE	21874273		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	18493134, 21164260		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	19583818		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	18091432, 19738481, 22950382, 25554071, 29973058		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	29973058	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	25069767, 26235034		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21323901, 24113216		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21323901, 23278282, 24113216		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29439084	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36734157	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12690088, 20140850, 22837373, 23719679, 29439084, 30081191, 31269743		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	31306370		★☆☆☆☆ Found in Text Mining only
Disorders of Porphyrin Metabolism	Porphyria	BEFREE	12463733		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	22057025		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	30558382		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	31202118		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	29319893		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	14709152		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	18467089, 25374239		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	12161505, 19401614, 9024261		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10559661, 11994385, 15861041, 19342032, 19401614, 20553220, 22578533, 26058395, 26530052, 27920344, 9024261, 9973254		★☆☆☆☆ Found in Text Mining only
Eosinophilia-Myalgia Syndrome	Eosinophilia	BEFREE	7955801		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	19094056, 20089352, 24345815		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	35235559	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	9187662		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	9187662		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	35062050	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	24913135, 26937962, 27196572		★☆☆☆☆ Found in Text Mining only
Female Pseudohermaphroditism	Female Pseudohermaphroditism	BEFREE	9829218		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	12050211, 17276435, 8126151		★☆☆☆☆ Found in Text Mining only
Freeman-Sheldon syndrome	Freeman-Sheldon Syndrome	BEFREE	31600674		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	26456622	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	38554324	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	14635112, 29845210		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18421309		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36477472	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18421309		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19094056, 23909806, 29914177		★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	CTD_human_DG	11389073, 9766669		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	22380717		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	36277605	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	24020059		★☆☆☆☆ Found in Text Mining only
Glucocorticoid-remediable aldosteronism	Hyperaldosteronism	BEFREE	1472060		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	36211438	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21656078, 9486585		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35404482	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	18288954		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16183265		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	21237236		★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	30090615		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	25424204		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	25424204, 34752660	Associate	★☆☆☆☆ Found in Text Mining only
Hydrophthalmos	Glaucoma, congenital	BEFREE	19536304, 20051892		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	20066577	Associate	★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	10419001		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	19744523, 22759796		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	27588937		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	17142457		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	40532247	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31669385		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	28843775		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16498227, 16691295, 16822233, 18219097, 19483747, 20099993, 24338455, 25427230, 27298316, 31296661		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	21676446		★☆☆☆☆ Found in Text Mining only
Hypospadias, penoscrotal	Hypospadias	BEFREE	22968487		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	24974574		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30320358	Inhibit	★☆☆☆☆ Found in Text Mining only
ICHTHYOSIS, LAMELLAR, 3	Ichthyosis	BEFREE	16436457, 25069767		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	16546968, 28816644		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	19342032	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	29709540		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24368200, 26423716		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	17335546	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	25427230		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	15248218	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	19814645		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	15248218, 15700027		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	15248218		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	20878158, 7789992		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24586425, 26107207, 32119768, 34397877	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20878158, 24586425, 26107207, 27865701		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	17502835, 26456622, 27858847		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	9316701		★☆☆☆☆ Found in Text Mining only
Leydig Cell Tumor	Leydig Cell Tumor	BEFREE	2340950		★☆☆☆☆ Found in Text Mining only
Lipoid congenital adrenal hyperplasia	Lipoid Congenital Adrenal Hyperplasia	BEFREE	7962293		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10519413, 10850415, 10984687, 11147830, 15026472, 16048566, 16077914, 19041150, 2161748, 22138474, 24151232, 28384415, 29949932, 30280198, 30720105, 6682173, 9589695		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18332083		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	24058572, 7741759		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	25798860	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	26602960, 37479763, 37512019	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11147830, 2161748, 22138474, 31836555, 6682173		★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	27333947	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	22070131		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	1521541		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23591849	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	7704004		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26456622	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	14611903, 17407229, 21543025, 24981927, 26456622		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	15248218, 21543025		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	22380717, 37915145	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12397416, 25677220		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25677220	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	16985026, 31688635		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	16985026		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	11309335, 15225832, 8789801		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21656078, 9486585		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10657957, 10731105, 12396873, 14555709, 14639129, 14970873, 15784178, 17440066, 18214058, 18618215, 20179710, 21402692, 22631658, 22702493, 22716309, 22938436, 23824676, 24682508, 25428516, 25554091, 26134484, 26652254, 28176668, 28178648, 28985473, 30461653, 31686598, 7893351		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	26925680		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	9589695		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10454258, 10639518, 1362539, 15746946, 1820735, 20034539, 20044584, 20515955, 23591849, 27750412, 28092945, 8299311, 9439147, 9610791, 9894148		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25516145		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17069538, 9439147		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17455229, 19425200, 20621111, 26921336, 28420543, 31382168		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18595017		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	18304215, 20675267, 8752158		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10335450, 10498401, 10503904, 10653131, 11113857, 11122850, 11498768, 12052216, 12237780, 12569554, 12846892, 1486838, 15180491, 15228172, 15237850, 16243813, 16293390, 16550168, 17853921, 17900751, 19823875, 2052000, 20878158, 21165551, 21184128, 21590276, 22789435, 25480734, 26411412, 28245756, 28645477, 29660159, 30362088, 31492698, 7666479, 8640822, 9582497, 9766669		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	16172230		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11280806, 12351690, 19800002, 20079471		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12738724		★☆☆☆☆ Found in Text Mining only
Mastocytosis Cutaneous	Mastocytosis	Pubtator	32752121	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	30320358		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	30320358	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24413391		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere disease	Pubtator	35741759	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	18091432, 19738481, 22950382, 25554071, 29973058		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	12587146		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	26172259, 28970799, 31202118		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30195417		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	20878158		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	27655857		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	35404482	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19736056		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28083951		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	20878158		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23684483	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	18414197, 24293093, 24671854		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	21476972, 24905532		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	24974574		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	1975560		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33931030	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10335450, 10800765, 10910056, 10927020, 11113857, 11280806, 11468695, 12052216, 12351690, 12396831, 15026557, 15712360, 15746054, 15970648, 16293390, 16546968, 17279585, 17853921, 18063021, 24413391, 25526449, 27922681, 29777725, 31612869, 8117355, 8313365, 8318421, 8789801, 9589695, 9661649		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	15180492		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29451034		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	27858847		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	27858847	Associate	★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C1	Sphingomyelinase deficiency	BEFREE	27019000		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27321734		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18508622, 21120482, 27922681		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	26937962		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	17968817, 22903471		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	17968817		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	30421529, 31202118		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35491971	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28403774		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	29040572		★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	19005482		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	35404482	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	23849849		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28944123, 3263289		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17279585		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	18782852, 21677034		★☆☆☆☆ Found in Text Mining only
Ovarian Granulosa Cell Tumor	Ovarian Tumor	BEFREE	8106605, 8263150		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25516145		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17069538, 9439147		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	10415878		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	30742590		★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	15363478		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	8627546, 9316701, 9539332		★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	21676446		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	22361517		★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	8106605, 8263150		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	10419001, 10852468, 15284005, 18467089, 19342032, 21262361, 23155436, 25208301, 25374239, 9455828		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	19342032	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	22018952		★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	11524733, 9453493		★☆☆☆☆ Found in Text Mining only
Porphyrias, Hepatic	Hepatic porphyria	BEFREE	14714565		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	18782852, 21677034		★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	23422825		★☆☆☆☆ Found in Text Mining only
Primary congenital glaucoma	Congenital glaucoma	BEFREE	14635112, 15342693, 16688110, 19247456, 21139974, 22942166		★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	BEFREE	3263289		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17455229, 19425200, 20621111, 26921336, 28420543, 31382168		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17455229		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31758502		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	17968817, 22903471		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	17968817		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	20118222		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29767774, 31564857	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28560400		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	27388155		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	27388155	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	7932410		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18425996, 20877299, 21148022		★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	23774940, 25147095		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	11263781		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16372909		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	27376429		★☆☆☆☆ Found in Text Mining only
Sexual Dysfunction	Sexual Dysfunction	BEFREE	12378847		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	12641443		★☆☆☆☆ Found in Text Mining only
Spasms Infantile	Infantile spasms	Pubtator	17391322	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	24117163		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15635577, 29743817		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17373732		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35404482	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24913135		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18595017		★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	19005482		★☆☆☆☆ Found in Text Mining only
Sturge-Weber Syndrome	Sturge-Weber Syndrome	BEFREE	20051892		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11263781, 28083951		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	37479763	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	9768687		★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	23774940, 25147095		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	9922108		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35579950	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29842871, 30551694		★☆☆☆☆ Found in Text Mining only
Urogenital Abnormalities	Urogenital Abnormalities	BEFREE	21705796		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	12050211, 16595228, 17276435, 8126151		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	19342032		★☆☆☆☆ Found in Text Mining only
Vitamin D-dependent rickets, type 1	Vitamin D-Dependent Rickets	BEFREE	9333115		★☆☆☆☆ Found in Text Mining only
Xanthomatosis, Cerebrotendinous	Cholestanol storage disease	BEFREE	27225395, 28229379		★☆☆☆☆ Found in Text Mining only