Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	155061
Gene name	Zinc finger protein 746
Gene symbol	ZNF746
Synonyms (NCBI Gene)	PARIS
Chromosome	7
Chromosome location	7q36.1

Show/Hide all (84)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052496	hsa-let-7a-5p	CLASH	23622248
MIRT051712	hsa-let-7d-5p	CLASH	23622248
MIRT043653	hsa-miR-326	CLASH	23622248
MIRT569633	hsa-miR-320e	PAR-CLIP	20371350
MIRT569632	hsa-miR-204-3p	PAR-CLIP	20371350
MIRT569631	hsa-miR-4646-5p	PAR-CLIP	20371350
MIRT569630	hsa-miR-5093	PAR-CLIP	20371350
MIRT569629	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT569628	hsa-miR-3153	PAR-CLIP	20371350
MIRT569627	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT569626	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT569633	hsa-miR-320e	PAR-CLIP	20371350
MIRT569632	hsa-miR-204-3p	PAR-CLIP	20371350
MIRT569631	hsa-miR-4646-5p	PAR-CLIP	20371350
MIRT569630	hsa-miR-5093	PAR-CLIP	20371350
MIRT569629	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT569628	hsa-miR-3153	PAR-CLIP	20371350
MIRT569627	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT569626	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT1538316	hsa-miR-101	CLIP-seq
MIRT1538317	hsa-miR-144	CLIP-seq
MIRT1538318	hsa-miR-193a-3p	CLIP-seq
MIRT1538319	hsa-miR-193b	CLIP-seq
MIRT1538320	hsa-miR-30a	CLIP-seq
MIRT1538321	hsa-miR-30b	CLIP-seq
MIRT1538322	hsa-miR-30c	CLIP-seq
MIRT1538323	hsa-miR-30d	CLIP-seq
MIRT1538324	hsa-miR-30e	CLIP-seq
MIRT1538325	hsa-miR-3119	CLIP-seq
MIRT1538326	hsa-miR-3926	CLIP-seq
MIRT1538327	hsa-miR-4508	CLIP-seq
MIRT1538328	hsa-miR-4640-5p	CLIP-seq
MIRT1538329	hsa-miR-4726-5p	CLIP-seq
MIRT1538330	hsa-miR-548s	CLIP-seq
MIRT1538331	hsa-miR-602	CLIP-seq
MIRT1538332	hsa-miR-615-5p	CLIP-seq
MIRT1538333	hsa-miR-3194-3p	CLIP-seq
MIRT1538334	hsa-miR-4267	CLIP-seq
MIRT1538335	hsa-miR-4663	CLIP-seq
MIRT2162637	hsa-miR-1265	CLIP-seq
MIRT2162638	hsa-miR-3074-5p	CLIP-seq
MIRT2162639	hsa-miR-3667-3p	CLIP-seq
MIRT2162640	hsa-miR-370	CLIP-seq
MIRT2162641	hsa-miR-4307	CLIP-seq
MIRT2162642	hsa-miR-4753-3p	CLIP-seq
MIRT2162643	hsa-miR-4768-5p	CLIP-seq
MIRT2162644	hsa-miR-4793-3p	CLIP-seq
MIRT2162645	hsa-miR-548n	CLIP-seq
MIRT2381728	hsa-miR-1283	CLIP-seq
MIRT2381729	hsa-miR-27a	CLIP-seq
MIRT2381730	hsa-miR-27b	CLIP-seq
MIRT2381731	hsa-miR-3065-5p	CLIP-seq
MIRT2162638	hsa-miR-3074-5p	CLIP-seq
MIRT1538320	hsa-miR-30a	CLIP-seq
MIRT1538321	hsa-miR-30b	CLIP-seq
MIRT1538322	hsa-miR-30c	CLIP-seq
MIRT1538323	hsa-miR-30d	CLIP-seq
MIRT1538324	hsa-miR-30e	CLIP-seq
MIRT2381732	hsa-miR-3123	CLIP-seq
MIRT2162639	hsa-miR-3667-3p	CLIP-seq
MIRT2162640	hsa-miR-370	CLIP-seq
MIRT2381733	hsa-miR-3919	CLIP-seq
MIRT2381734	hsa-miR-3977	CLIP-seq
MIRT2381735	hsa-miR-421	CLIP-seq
MIRT2381736	hsa-miR-4277	CLIP-seq
MIRT2381737	hsa-miR-4282	CLIP-seq
MIRT2381738	hsa-miR-4291	CLIP-seq
MIRT2381739	hsa-miR-4520a-3p	CLIP-seq
MIRT2381740	hsa-miR-4520b-3p	CLIP-seq
MIRT2381741	hsa-miR-4768-3p	CLIP-seq
MIRT2162644	hsa-miR-4793-3p	CLIP-seq
MIRT2381742	hsa-miR-513a-5p	CLIP-seq
MIRT2381743	hsa-miR-545	CLIP-seq
MIRT2381744	hsa-miR-548k	CLIP-seq
MIRT2162645	hsa-miR-548n	CLIP-seq
MIRT2381745	hsa-miR-604	CLIP-seq
MIRT1538332	hsa-miR-615-5p	CLIP-seq
MIRT2381746	hsa-miR-647	CLIP-seq
MIRT2381747	hsa-miR-890	CLIP-seq
MIRT2381748	hsa-miR-891b	CLIP-seq
MIRT2397723	hsa-miR-3929	CLIP-seq
MIRT2397724	hsa-miR-4419b	CLIP-seq
MIRT2397725	hsa-miR-4478	CLIP-seq
MIRT2397726	hsa-miR-485-5p	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	21376232
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	21376232
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	21376232
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	21376232
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	21376232
GO:0005515	Function	Protein binding	IPI	21376232, 31856708
GO:0005634	Component	Nucleus	IC	21376232
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	21376232
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	21376232
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	31856708
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	21376232
GO:0046872	Function	Metal ion binding	IEA
GO:0051260	Process	Protein homooligomerization	IDA	31856708
GO:0051291	Process	Protein heterooligomerization	IDA	31856708

MIM	HGNC	e!Ensembl
613914	21948	ENSG00000181220

Q6NUN9

Protein name

Zinc finger protein 746 (Parkin-interacting substrate) (PARIS)

Protein function

Transcription repressor that specifically binds to the 5'-TATTTT[T/G]-3' consensus sequence on promoters and repress transcription of PGC-1-alpha (PPARGC1A), thereby playing a role in regulation of neuron death. {ECO:0000269|PubMed:21376232, ECO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12417	DUF3669	11 → 81	Zinc finger protein	Family
PF01352	KRAB	106 → 136	KRAB box	Family
PF00096	zf-C2H2	510 → 532	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	538 → 560	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	566 → 588	Zinc finger, C2H2 type	Domain

Sequence

MAEAVAAPISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQL
EGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGESPKEWGKLEDWQKEL
YKHVMRGNYETLVSLDYAISKPEVLSQIEQGKEPCNWRRPGPKIPDVPVDPSPGSGPPVP
APDLLMQIKQEGELQLQEQQALGVEAWAAGQPDIGEEPWGLSQLDSGAGDISTDATSGVH
SNFSTTIPPTSWQTDLPPHHPSSACSDGTLKLNTAASTEDVKIVIKTEVQEEEVVATPVH
PTDLEAHGTLFGPGQATRFFPSPAQEGAWESQGSSFPSQDPVLGLREPARPERDMGELSP
AVAQEETPPGDWLFGGVRWGWNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRP
FNEPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTCATCGKSFQLQVSLSAHQRSCGAPDG
SGPGTGGGGSGSGGGGGGSGGGSARDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPC
TECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHAAGAKTPARGQP
LPTPPAPPDPFKSPASKGPLASTDLVTDWTCGLSVLGPTDGGDM

Sequence length

644

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	30029980, 30606052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	39519104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33929972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29870385, 30227855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29628506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34440834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30681195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30598387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30372570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24145959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24145959, 27185595, 28939041, 31237944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31856708, 38103579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF746 (zinc finger protein 746)